Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.02
PubTator Score 0.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.400 5.7e-04
astrocytoma -1.100 4.5e-03
atypical teratoid / rhabdoid tumor -2.200 2.4e-07
ependymoma -1.200 2.5e-06
gastric cancer 1.500 9.5e-03
glioblastoma -1.100 7.9e-03
group 4 medulloblastoma -1.800 3.0e-05
medulloblastoma, large-cell -2.000 2.2e-06
osteosarcoma -1.117 7.9e-03
ovarian cancer -1.700 2.9e-07
pancreatic ductal adenocarcinoma liver m... -1.012 5.4e-03
Parkinson's disease -1.100 8.7e-03
Pick disease -1.400 1.0e-04
pituitary cancer -1.100 2.4e-05
primitive neuroectodermal tumor -1.100 9.7e-04
psoriasis 1.200 1.7e-32

AA Sequence

MKRLGSVQRKMPCVFVTEVKEEPSSKREHQPFKVLATETVSHKALDADIYSAIPTEKVDGTCCYVTTYKD      1 - 70
QPYLWARLDRKPNKQAEKRFKNFLHSKENPKEFFWNVEEDFKPAPECWIPAKETEQINGNPVPDENGHIP     71 - 140
GWVPVEKNNKQYCWHSSVVNYEFEIALVLKHHPDDSGLLEISAVPLSDLLEQTLELIGTNINGNPYGLGS    141 - 210
KKHPLHLLIPHGAFQIRNLPSLKHNDLVSWFEDCKEGKIEGIVWHCSDGCLIKVHRHHLGLCWPIPDTYM    211 - 280
NSRPVIINMNLNKCDSAFDIKCLFNHFLKIDNQKFVRLKDIIFDV                             281 - 325
//

Text Mined References (10)

PMID Year Title