Property Summary

NCBI Gene PubMed Count 8
PubMed Score 257.53
PubTator Score 8.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 4.6e-05
lung cancer 4473 3.7e-03

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.600 3.7e-03
ovarian cancer 1.500 4.6e-05

Synonym

Accession Q9HB07
Symbols MYG
MYG1
Gamm1
MST024
MSTP024

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
23706493 Significant increase in MYG1 mRNA expression was observed in vitiligo patients compared to controls. The MYG1 mRNA expression was increased in patients with active and generalized vitiligo as compared to stable and localized vitiligo.
20377893 Observational study of gene-disease association. (HuGE Navigator)
20377893 Both MYG1 promoter polymorphism and Arg4Gln polymorphism in the mitochondrial signal of Myg1 have an impact on the regulation of the MYG1 gene and promoter polymorphism is related with suspectibility for actively progressing vitiligo.
19014353 Human and mouse MYG1 is ubiquitously expressed, with the highest level in the testis.
16996721 demonstrates possible role of MYG1 in vitiligo

AA Sequence

MGHQFLRGLLTLLLPPPPLYTRHRMLGPESVPPPKRSRSKLMAPPRIGTHNGTFHCDEALACALLRLLPE      1 - 70
YRDAEIVRTRDPEKLASCDIVVDVGGEYDPRRHRYDHHQRSFTETMSSLSPGKPWQTKLSSAGLIYLHFG     71 - 140
HKLLAQLLGTSEEDSMVGTLYDKMYENFVEEVDAVDNGISQWAEGEPRYALTTTLSARVARLNPTWNHPD    141 - 210
QDTEAGFKRAMDLVQEEFLQRLDFYQHSWLPARALVEEALAQRFQVDPSGEIVELAKGACPWKEHLYHLE    211 - 280
SGLSPPVAIFFVIYTDQAGQWRIQCVPKEPHSFQSRLPLPEPWRGLRDEALDQVSGIPGCIFVHASGFTG    281 - 350
GHHTREGALSMARATLAQRSYLPQIS                                                351 - 376
//

Text Mined References (12)

PMID Year Title
23706493 2013 Correlation of increased MYG1 expression and its promoter polymorphism with disease progression and higher susceptibility in vitiligo patients.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20377893 2010 Promoter polymorphism -119C/G in MYG1 (C12orf10) gene is related to vitiligo susceptibility and Arg4Gln affects mitochondrial entrance of Myg1.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19014353 2009 Characterization of MYG1 gene and protein: subcellular distribution and function.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16996721 2006 MYG1, novel melanocyte related gene, has elevated expression in vitiligo.
16541075 2006 The finished DNA sequence of human chromosome 12.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.