Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.9e-08
psoriasis 6694 1.4e-05

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.763 1.9e-08
psoriasis -1.100 1.4e-05

AA Sequence

MVLAMLGALHPRAGLSLFLHLILAVALLRSQPLRSQRSVPEAFSAPLELSQPLSGLVDDYGILPKHPRPR      1 - 70
GPRPLLSRAQQRKRDGPDLAEYYYDAHL                                               71 - 98
//

Text Mined References (2)

PMID Year Title