Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -3.200 1.2e-03
oligodendroglioma -3.200 5.3e-22
glioblastoma -4.400 1.4e-06
osteosarcoma -1.207 6.2e-03
ependymoma -2.000 2.2e-04
medulloblastoma -3.600 2.1e-07
atypical teratoid / rhabdoid tumor -4.100 2.1e-09
medulloblastoma, large-cell -2.600 1.0e-02
primitive neuroectodermal tumor -2.400 1.6e-02
adult high grade glioma -3.900 3.0e-05
pilocytic astrocytoma -4.000 2.7e-09
pituitary cancer 1.500 3.7e-03
psoriasis 1.100 3.9e-09

Synonym

Accession Q6NUJ2 B4E169
Symbols NEURIM1
LOH11CR1A

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSARAPKELRLALPPCLLNRTFASPNASGSGNTGARGPGAVGSGTCITQVGQQLFQSFSSTLVLIVLVTL      1 - 70
IFCLIVLSLSTFHIHKRRMKKRKMQRAQEEYERDHCSGSRGGGGLPRPGRQAPTHAKETRLERQPRDSPF     71 - 140
CAPSNASSLSSSSPGLPCQGPCAPPPPPPASSPQGAHAASSCLDTAGEGLLQTVVLS                 141 - 197
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.