Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -3.000 1.4e-03
astrocytic glioma -2.600 1.1e-03
Astrocytoma, Pilocytic -3.500 7.4e-07
atypical teratoid / rhabdoid tumor -3.900 1.3e-10
ependymoma -2.000 2.2e-04
glioblastoma -3.100 1.9e-08
group 4 medulloblastoma -3.100 9.4e-04
medulloblastoma, large-cell -2.500 1.7e-02
oligodendroglioma -2.500 1.7e-03
osteosarcoma -1.207 6.2e-03
pituitary cancer 1.400 5.3e-03
primitive neuroectodermal tumor -2.400 1.6e-02
psoriasis 1.100 3.9e-09

Synonym

Accession Q6NUJ2 B4E169
Symbols NEURIM1
LOH11CR1A

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

AA Sequence

MSARAPKELRLALPPCLLNRTFASPNASGSGNTGARGPGAVGSGTCITQVGQQLFQSFSSTLVLIVLVTL      1 - 70
IFCLIVLSLSTFHIHKRRMKKRKMQRAQEEYERDHCSGSRGGGGLPRPGRQAPTHAKETRLERQPRDSPF     71 - 140
CAPSNASSLSSSSPGLPCQGPCAPPPPPPASSPQGAHAASSCLDTAGEGLLQTVVLS                 141 - 197
//

Text Mined References (7)

PMID Year Title