Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.50
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.400 6.9e-05
Astrocytoma, Pilocytic -1.300 2.4e-06
Chronic Lymphocytic Leukemia 1.133 2.6e-04
glioblastoma -1.200 1.0e-04
lung carcinoma 1.200 1.4e-21
medulloblastoma, large-cell -1.300 2.7e-04
non-small cell lung carcinoma 1.100 5.3e-35
osteosarcoma -1.882 1.3e-07
pancreatic ductal adenocarcinoma liver m... 1.100 3.3e-02
pituitary cancer 1.300 2.5e-06

Gene RIF (1)

AA Sequence

MEGTAVAVFEILRFLIIHWKCDIDVSKGALLEGQLVISIEGLNSKHQANALHCVTTVASAGSLFGGMVLK      1 - 70
KFLKEIQSILPGISAKLTWTSEEGSYSQDMTGVTPFQMIFEVDEKPRTLMTDCLVIKHFLRKIIMVHPKV     71 - 140
RFHFSVKVNGILSTEIFGVENEPTLNLGNGIALLVDSQHYVRPNFGTIESHCSRIHPVLGHPVMLFIPED    141 - 210
VAGMDLLGELILTPAAALCPSPKVSSNQLNRISSVSIFLYGPLGLPLILSTWEQPMTTFFKDTSSLVDWK    211 - 280
KYHLCMIPNLDLNLDRDLVLPDVSYQVESSEEDQSQTMDPQGQTLLLFLFVDFHSAFPVQQMEIWGVYTL    281 - 350
LTTHLNAILVESHSVVQGSIQFTVDKVLEQHHQAAKAQQKLQASLSVAVNSIMSILTGSTRSSFRKMCLQ    351 - 420
TLQAADTQEFRTKLHKVFREITQHQFLHHCSCEVKQQLTLEKKDSAQGTEDAPDNSSLELLADTSGQAEN    421 - 490
KRLKRGSPRIEEMRALRSARAPSPSEAAPRRPEATAAPLTPRGREHREAHGRALAPGRASLGSRLEDVLW    491 - 560
LQEVSNLSEWLSPSPGP                                                         561 - 577
//

Text Mined References (9)

PMID Year Title