Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.100 1.9e-02
intraductal papillary-mucinous carcinoma... -1.300 2.7e-04
ovarian cancer -1.100 3.2e-04
posterior fossa group B ependymoma 1.200 4.2e-06

 GO Component (1)

Gene RIF (2)

AA Sequence

MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSENIFTSAKVT      1 - 70
HKNEADDYHLRNKTIFLRTSSQCLEEQVDNFLDLEDLDMDEEIKPQMSEDLLLLPGEVEQDVSTSIPSCI     71 - 140
PFVAQPPTCEVKPKPSVKRMDKQTEEILGDEVQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRK    141 - 210
DTSPDLEKSCD                                                               211 - 221
//

Text Mined References (15)

PMID Year Title