Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.100 1.9e-02
intraductal papillary-mucinous carcinoma... -1.300 2.7e-04
posterior fossa group B ependymoma 1.200 4.2e-06
ovarian cancer -1.100 3.2e-04

Synonym

Accession Q86VG3 D3DR18 Q96DD6
Symbols NWC
HEPIS

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
19773279 Observational study of gene-disease association. (HuGE Navigator)
16157265 identification of HEPIS as a protein that binds nsp10 of SARS-CoV

AA Sequence

MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSENIFTSAKVT      1 - 70
HKNEADDYHLRNKTIFLRTSSQCLEEQVDNFLDLEDLDMDEEIKPQMSEDLLLLPGEVEQDVSTSIPSCI     71 - 140
PFVAQPPTCEVKPKPSVKRMDKQTEEILGDEVQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRK    141 - 210
DTSPDLEKSCD                                                               211 - 221
//

Text Mined References (15)

PMID Year Title
26703212 2016 Search for the Function of NWC, Third Gene Within RAG Locus: Generation and Characterization of NWC-Deficient Mice.
26186194 2015 The BioPlex Network: A Systematic Exploration of the Human Interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21478494 2011 Genome-wide association study identifies nidogen 1 (NID1) as a susceptibility locus to cutaneous nevi and melanoma risk.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
18433331 2008 Identification of a novel transcriptional repressor (HEPIS) that interacts with nsp-10 of SARS coronavirus.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16157265 2005 The interaction of the SARS coronavirus non-structural protein 10 with the cellular oxido-reductase system causes an extensive cytopathic effect.
15971274 2005 Identification of a third evolutionarily conserved gene within the RAG locus and its RAG1-dependent and -independent regulation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12766061 2003 Gene expression profile of the human trabecular meshwork: NEIBank sequence tag analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.