Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.80
PubTator Score 1.00

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
osteosarcoma 7766 5.4e-10
diabetes mellitus 1683 1.0e-03
Disease Target Count Z-score Confidence
Testicular cancer 25 3.571 1.8


  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.500 1.0e-03
osteosarcoma 2.912 5.4e-10


Accession Q8NBR9


 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

QRICLPPNLALVLLGALWTSPPPGSFLQPPYNRPYKLYKTN                                 211 - 251

Text Mined References (6)

PMID Year Title