Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.25
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 3.0
Disease Target Count
Ataxia telangiectasia 34

Expression

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQIVKYINPKEAELLDAAAGIHV      1 - 70
RFRLGGVKFPPDIYYKIFTHRPIEDLCANSPRNYAKLPAKHTSHNKNDHLQEEDHSGWYHRIENNGWRPV     71 - 140
SDTFWLSTDGMVVEDKKESEFHFSKLKRRQDLEKKRKLRKIEWMRQMYYSGSLEAKSTHHETLGLIHTAT    141 - 210
KGLIRAFEDGGIDSVMEWEVDEVLNWTNTLNFDEYIASWKEIATSNSSANFKGFRFNQAQKNIYNYGGDI    211 - 280
SKMQMGIPDDTYYENVYQEPNVTRLTPDSTYGL                                         281 - 313
//

Text Mined References (11)

PMID Year Title