Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.22
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma 1.300 4.9e-02
oligodendroglioma 1.400 2.5e-02
ependymoma 1.100 5.2e-07
glioblastoma 1.400 5.1e-04
medulloblastoma 1.500 1.7e-06
atypical teratoid / rhabdoid tumor 1.700 1.7e-06
medulloblastoma, large-cell 2.100 2.8e-04
primitive neuroectodermal tumor 1.900 7.0e-07
acute quadriplegic myopathy 1.012 6.0e-04
adrenocortical carcinoma -1.478 1.6e-05
tuberculosis and treatment for 6 months -1.100 1.8e-03
non-small cell lung cancer -1.090 9.1e-12
adult high grade glioma 1.500 5.9e-04
pilocytic astrocytoma 1.100 2.8e-04
aldosterone-producing adenoma -1.406 2.7e-02
Pick disease 1.700 2.4e-05
ulcerative colitis -1.100 1.6e-04
ovarian cancer -1.300 1.1e-04

AA Sequence

MACAEFSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLP      1 - 70
LVNQKKVYDLNKIAKEIKLPGAFILGAGAGPFQTLGFNSEFMPVIQTESEHKPPVNGSYFAHVNPADGGC     71 - 140
LLEKYSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLNFVTCMRETLEKHYGNKPIGMGGTFIIQ    141 - 210
KGKVKSHIMPAEFSSCPLNSDEEVNKWLHFYEMKAPLVCLPVFVSRDPGFDLRLEHTHFFSRHGEGGHYH    211 - 280
YDTTPDIVEYLGYFLPAEFLYRIDQPKETHSIGRD                                       281 - 315
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19060904 2009 An empirical framework for binary interactome mapping.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16522806 2006 Crystal structure of Homo sapiens PTD012 reveals a zinc-containing hydrolase fold.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.