Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.71
PubTator Score 1.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8IXP5
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (0)

AA Sequence

MPGSPVTSGYYGVRRSFLSDSDFHNSKQFSNDVYTSSVGKPFPCESSAGQSHAALLEPYFPQEPYGDYRP      1 - 70
PALTPNAGSLFSASPLPPLLPPPFPGDPAHFLFRDSWEQTLPDGLSQPDPVSADALLTLPPSTSCLSQLE     71 - 140
SGSIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSNDLPPKVGPLSPDEEADTG    141 - 210
SLHDPSPWVKEDGSIAWGSYECRRAY                                                211 - 236
//

Text Mined References (4)

PMID Year Title
25048349 Open reading frames associated with cancer in the dark matter of the human genome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.