Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus -1.200 3.4e-03
lung carcinoma 1.100 2.4e-16
medulloblastoma -1.100 6.5e-06
medulloblastoma, large-cell -1.500 4.4e-04
non primary Sjogren syndrome sicca 1.100 1.9e-02
osteosarcoma 1.136 8.2e-05
ovarian cancer 1.600 7.2e-06

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MLSPERLALPDYEYLAQRHVLTYMEDAVCQLLENREDISQYGIARFFTEYFNSVCQGTHILFREFSFVQA      1 - 70
TPHNRVSFLRAFWRCFRTVGKNGDLLTMKEYHCLLQLLCPDFPLELTQKAARIVLMDDAMDCLMSFSDFL     71 - 140
FAFQIQFYYSEFLDSVAAIYEDLLSGKNPNTVIVPTSSSGQHRQRPALGGAGTLEGVEASLFYQCLENLC    141 - 210
DRHKYSCPPPALVKEALSNVQRLTFYGFLMALSKHRGINQALGALPDKGDLMHDPAMDEELERLLAQVPG    211 - 280
LVNSVTASPEASCLPSRTPPRVGSPWRPLHHSRKVDGESDGSTEETDESET                       281 - 331
//

Text Mined References (18)

PMID Year Title