| Disease | Target Count |
|---|---|
| Acne vulgaris | 16 |
| Disease | Target Count | P-value |
|---|---|---|
| lung carcinoma | 2844 | 2.4e-16 |
| medulloblastoma | 1524 | 6.5e-06 |
| ovarian cancer | 8491 | 7.2e-06 |
| osteosarcoma | 7933 | 8.2e-05 |
| medulloblastoma, large-cell | 6234 | 4.4e-04 |
| cutaneous lupus erythematosus | 1056 | 3.4e-03 |
| non primary Sjogren syndrome sicca | 840 | 1.9e-02 |
| Disease | log2 FC | p |
|---|---|---|
| cutaneous lupus erythematosus | -1.200 | 3.4e-03 |
| osteosarcoma | 1.136 | 8.2e-05 |
| medulloblastoma | -1.100 | 6.5e-06 |
| medulloblastoma, large-cell | -1.500 | 4.4e-04 |
| non primary Sjogren syndrome sicca | 1.100 | 1.9e-02 |
| lung carcinoma | 1.100 | 2.4e-16 |
| ovarian cancer | 1.600 | 7.2e-06 |
| PMID | Text | |
|---|---|---|
| 20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) |
MLSPERLALPDYEYLAQRHVLTYMEDAVCQLLENREDISQYGIARFFTEYFNSVCQGTHILFREFSFVQA 1 - 70 TPHNRVSFLRAFWRCFRTVGKNGDLLTMKEYHCLLQLLCPDFPLELTQKAARIVLMDDAMDCLMSFSDFL 71 - 140 FAFQIQFYYSEFLDSVAAIYEDLLSGKNPNTVIVPTSSSGQHRQRPALGGAGTLEGVEASLFYQCLENLC 141 - 210 DRHKYSCPPPALVKEALSNVQRLTFYGFLMALSKHRGINQALGALPDKGDLMHDPAMDEELERLLAQVPG 211 - 280 LVNSVTASPEASCLPSRTPPRVGSPWRPLHHSRKVDGESDGSTEETDESET 281 - 331 //
| PMID | Year | Title | |
|---|---|---|---|
| 25416956 | 2014 | A proteome-scale map of the human interactome network. | |
| 24399259 | 2014 | Two new susceptibility loci 1q24.2 and 11p11.2 confer risk to severe acne. | |
| 21502573 | 2011 | Genetic predictors of fibrin D-dimer levels in healthy adults. | |
| 20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | ||
| 18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. | |
| 17207965 | 2007 | hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes. | |
| 16713569 | 2006 | A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration. | |
| 16554811 | 2006 | Human chromosome 11 DNA sequence and analysis including novel gene identification. | |
| 16381901 | 2006 | The LIFEdb database in 2006. | |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. | |
| 16189514 | 2005 | Towards a proteome-scale map of the human protein-protein interaction network. | |
| 15489336 | 2004 | From ORFeome to biology: a functional genomics pipeline. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 11230166 | 2001 | Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. | |
| 11076863 | 2000 | DNA cloning using in vitro site-specific recombination. | |
| 8889548 | 1996 | Normalization and subtraction: two approaches to facilitate gene discovery. |
