Property Summary

NCBI Gene PubMed Count 2
PubMed Score 62.67
PubTator Score 74.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1683 1.1e-03
Disease Target Count Z-score Confidence
alcohol-related birth defect 3 4.108 2.1
Delusional disorder 13 3.301 1.7

Gene RIF (1)

AA Sequence

MALVQALVPREREPKLSILQMDRGDPQHSSHWCPEREKVKLLTLKPRETSKNILINFYRAFNLDKDVFIH      1 - 70
QANHPLTVPSSVVMGDNGHTLAEDDKRPCFRVLPCYLERVSSGISISWISAPLPVGAMKHQLLCDLMDLI     71 - 140
TLSFWLAGQCMSLKATNMQHCKCSIATSDWAIELDRTDYKTLPSEYSILALLQVFAGKNCMDRVLLHVDV    141 - 210
NYLKSLP                                                                   211 - 217
//

Text Mined References (2)

PMID Year Title