Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
posterior fossa group B ependymoma 416 1.1e-06
psoriasis 6694 1.9e-04
medulloblastoma, large-cell 6241 6.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.400 6.6e-04
posterior fossa group B ependymoma 1.200 1.1e-06
psoriasis 1.800 1.9e-04

AA Sequence

MESSTGPRMPLLKYCSVATSLKAPGWDGAAPPWDLSFTYPFALQAPWLTGHKPLARHASSCPCLHVADPA      1 - 70
WQGPGWLGRAGDAANTWVLARREADGFYYRAQIKATPELERQGVLLVEFEAPLVAGPKLPAQQQRVVLEE     71 - 140
DVIPLSPSVGYSLRPGDKVLALWEPGQQQYGPGTVLLGLEMRDPQRASKEKEITVHFWNGKAAKVPLGGV    141 - 210
QSVSLTIWKKAVERLHKSFTREHPRPLHWAPCCSLLGPITGRITNELPPDAPFLCPLCHHHACCQLLCQG    211 - 280
CLCGCPPCGTTWWPLTRTSEVMARELPELEPTAQLLPLEGPKEEKVAMHAPLAVSSSSSSSCEQDGVEND    281 - 350
LEMGPPQRLMVNSAVNTDPIFLEMPLRQSGLCQPEWRYWKRNGPEPCLGKPGTRYSNICKEEKDHKQQRA    351 - 420
QTAVVGTTKELVSKATHMKPPRTPPGEAEHRKRSQSLAICQWNKNSR                           421 - 467
//

Text Mined References (8)

PMID Year Title