Property Summary

NCBI Gene PubMed Count 4
PubMed Score 63.71
PubTator Score 32.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.700 6.6e-04
glioblastoma 1.700 1.7e-04
medulloblastoma 1.200 1.5e-02
medulloblastoma, large-cell 2.100 4.3e-05
Atopic dermatitis 3.300 1.5e-03
non-small cell lung cancer 1.893 5.3e-08
active ulcerative colitis -3.093 4.4e-02
interstitial cystitis -5.400 2.2e-06
cystic fibrosis 1.900 1.8e-02
adult high grade glioma 2.000 6.8e-04
psoriasis 5.400 1.9e-76
Endometriosis -1.011 4.5e-02
ovarian cancer 2.300 1.5e-11

Gene RIF (1)

PMID Text
25585381 Compared with other antimicrobial peptides, AP-57 has its distinct characteristics, including longer sequence length, four cysteines, highly cationic character, cell-specific toxicity, DNA binding and tissue-specific expressing patterns.

AA Sequence

MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPR      1 - 70
LWVVPGALPQV                                                                71 - 81
//

Text Mined References (4)

PMID Year Title
25585381 2015 AP-57/C10orf99 is a new type of multifunctional antimicrobial peptide.
25351403 2014 CSBF/C10orf99, a novel potential cytokine, inhibits colon cancer cell growth through inducing G1 arrest.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.