Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.38
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
sarcoidosis 370 3.384 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.800 3.1e-21
lung carcinoma -1.800 2.6e-17
non-small cell lung carcinoma -1.600 7.1e-40
posterior fossa group B ependymoma 1.200 3.6e-04

Gene RIF (1)

AA Sequence

MMALVRDRRAHYVMSIVIRWVHCFSSSLRGTFGTRWEAMKAKATELRVCCARRKREAREFKPPQMRGSTR      1 - 70
LNISDDLKIGFFSTDHATQTDSSEILSVKELSSSTQKLAQMMKSLQVDFGFLKQLLQLKFEDRLKEESLS     71 - 140
LFTILHDRILEIEKHYQQNEDKMRKSFNQQLADAIAVIKGMYQQFFEVEEENVSLQDASTVKTNILLRKL    141 - 210
KEKEEVIKELKEELDQYKDFGFHKMESFAKETSSPKSNLEKENLEYKVENERLLQIISELEEEIQINLKE    211 - 280
NSGLEDELISMKEMAEKDHKTIQKLMDSRDRLREELHYEKSLVQDVINKQKEDKEMRKKYGSLSVKVARS    281 - 350
AKGREASLSPWPKSPPSTTALRPHSATMSVSSAGAQKAKMPKKALKEDQAVVEDKHGLESQIEALKANLE    351 - 420
NEKKKVERFRKEADRLNKSWEKRFFILRNSFHVLKNEMFTRHTLFRQFAVLADTSFNYIKVKPLLVQSRT    421 - 490
TMTAISSSSHCTSSIDGKHVDVVSDQAALQLSPKGKLSESPKEESLEEPSMRQSSPAETVD             491 - 551
//

Text Mined References (7)

PMID Year Title