Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Inflammatory Bowel Diseases 87
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0
Disease Target Count
Quebec platelet disorder 2

Gene RIF (2)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFLHLDSHSSLERTKPTVVGVDTHMELDEVHCCPGRDSGGGFIKGPMLQGLQGEGKLAPIPKPTLPSPSR      1 - 70
LTLFVSSSQMEDHGFPARRNGLTQASFIYQMPAGWGSPGGLFLPCQPVPTPVVLKPPLPPCPISWGESGP     71 - 140
AVDGIRRTPAP                                                               141 - 151
//

Text Mined References (7)

PMID Year Title
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.