Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.1e-02
Disease Target Count Z-score Confidence
Meningioma 41 3.037 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 2.1e-02

Gene RIF (1)

AA Sequence

MPKNAVVILRYGPYSAAGLPVEHHTFRLQGLQAVLAIDGHEVILEKIEDWNVVELMVNEEVIFHCNIKDL      1 - 70
EFGGDGKLDPLCEKARIAVLNAY                                                    71 - 93
//

Text Mined References (6)

PMID Year Title