Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.14

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MSTEGPSLASSPAISPLAFLSAPVTPGTLAEATDPLPMLIALACIFLLLATCLLFMTLCKPAALDPSRRR      1 - 70
AHECMPHHPGSPSEPQLRLWKRLGSLRLSLHSFRHGRPTVPRQPLPGPEDNRSHCDYMESTKM            71 - 133
//

Text Mined References (3)

PMID Year Title