1. Home
  2. Targets
  3. nucleic acid binding
  4. nuclease
  5. translation factor
  6. translation initiation factor
  7. Basic leucine zipper and W2 domain-containing protein 1

Tbio Basic leucine zipper and W2 domain-containing protein 1

Enhances histone H4 gene transcription but does not seem to bind DNA directly.

 Comments

Property Summary

NCBI Gene PubMed Count 20
PubMed Score 25.06
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Melanoma 261
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 156 0.0 2.0
Disease Target Count Z-score Confidence
Phlebotomus fever 6 3.323 1.7
Endometritis 21 3.056 1.5

Expression

  Differential Expression (22)

Disease log2 FC p
Multiple myeloma 1.859 4.9e-04
astrocytic glioma -2.400 1.4e-02
ependymoma -2.800 1.9e-02
oligodendroglioma -2.400 1.7e-02
osteosarcoma -1.993 2.5e-05
glioblastoma -1.700 9.6e-05
atypical teratoid / rhabdoid tumor -2.000 1.2e-06
group 4 medulloblastoma -1.300 1.5e-03
medulloblastoma, large-cell -1.900 9.5e-04
autosomal dominant Emery-Dreifuss muscul... 1.071 3.0e-03
juvenile dermatomyositis 1.401 3.3e-12
acute quadriplegic myopathy 1.758 2.1e-07
adrenocortical carcinoma -1.583 1.9e-04
pancreatic ductal adenocarcinoma liver m... -1.557 6.8e-03
lung cancer 1.100 1.3e-02
Breast cancer 2.700 3.8e-02
adult high grade glioma -1.700 8.9e-05
pilocytic astrocytoma -1.200 1.2e-03
psoriasis 1.200 5.6e-58
ovarian cancer -1.600 3.8e-05
pancreatic cancer 1.200 9.9e-03
dermatomyositis 1.300 2.7e-03

Synonym

Accession Q7L1Q6 B4DLZ8 B4DWF7 Q14281 Q15394 Q9BUY0
Symbols BZAP45
Nbla10236

Gene

BZW1

PANTHER Protein Class (4)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (9)

 GO Function (2)

 GO Component (3)

 GO Process (2)

 Compartment GO Term (13)

 HCA RNA Cell Line (56)

See all...

Pathway (1)

Protein-protein Interaction (5)

BZW2   ENPP1   SCCPDH   RNF138   TMEM43  

Gene RIF (3)

PMID Text
21734401 Data indicate taht candidate genes ACTB, BZW, OCM, MACC1, NXPH1, PRPS1L1, RAC1 and RPA3, which lie within the DFNB90 region, were sequenced and no potentially causal variants were identified.
19446954 BZW1 is a novel factor, promoting the growth of MEC cells
11524015 Stimulates cell cycle regulation of histone H4 gene transcription.

AA Sequence 

MNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRRYAETL      1 - 70
FDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLEKGFEDEVKKLLLFLK     71 - 140
GFSESERNKLAMLTGVLLANGTLNASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDINAVAASLRKVS    141 - 210
MDNRLMELFPANKQSVEHFTKYFTEAGLKELSEYVRNQQTIGARKELQKELQEQMSRGDPFKDIILYVKE    211 - 280
EMKKNNIPEPVVIGIVWSSVMSTVEWNKKEELVAEQAIKHLKQYSPLLAAFTTQGQSELTLLLKIQEYCY    281 - 350
DNIHFMKAFQKIVVLFYKAEVLSEEPILKWYKDAHVAKGKSVFLEQMKKFVEWLKNAEEESESEAEEGD     351 - 419
//

Text Mined References (30)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21734401 2011 Novel autosomal recessive nonsyndromic hearing impairment locus DFNB90 maps to 7p22.1-p15.3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19446954 2009 BZW1, a novel proliferation regulator that promotes growth of salivary muocepodermoid carcinoma.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11524015 2001 Purification and functional analysis of a novel leucine-zipper/nucleotide-fold protein, BZAP45, stimulating cell cycle regulated histone H4 gene transcription.
10964520 2000 A physical and transcript map based upon refinement of the critical interval for PPH1, a gene for familial primary pulmonary hypertension. The International PPH Consortium.
10942595 2000 A visual intracellular classification strategy for uncharacterized human proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7584028 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1 (supplement).
7584026 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1.