Property Summary

NCBI Gene PubMed Count 25
PubMed Score 15.61
PubTator Score 16.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.100 2.5e-05
psoriasis 1.100 6.6e-03
non-small cell lung cancer 1.218 2.3e-15
lung cancer 1.800 2.4e-04
group 3 medulloblastoma 1.500 9.2e-05
lung adenocarcinoma 1.200 8.7e-08

 GO Function (1)

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (4)

PMID Text
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20805244 bystin is necessary for efficient cleavage of the internal transcribed spacer 1 at site 2 and for further processing of the pre-rRNA.
17917702 review of the roles of bystin in embryo implantation, assembly of ribosomes, and as a target of c-MYC
17381424 These results suggest that, while bystin may play multiple roles in mammalian cells, a conserved function is to facilitate ribosome biogenesis required for cell growth.

AA Sequence

MPKFKAARGVGGQEKHAPLADQILAGNAVRAGVREKRRGRGTGEAEEEYVGPRLSRRILQQARQQQEELE      1 - 70
AEHGTGDKPAAPRERTTRLGPRMPQDGSDDEDEEWPTLEKAATMTAAGHHAEVVVDPEDERAIEMFMNKN     71 - 140
PPARRTLADIIMEKLTEKQTEVETVMSEVSGFPMPQLDPRVLEVYRGVREVLSKYRSGKLPKAFKIIPAL    141 - 210
SNWEQILYVTEPEAWTAAAMYQATRIFASNLKERMAQRFYNLVLLPRVRDDVAEYKRLNFHLYMALKKAL    211 - 280
FKPGAWFKGILIPLCESGTCTLREAIIVGSIITKCSIPVLHSSAAMLKIAEMEYSGANSIFLRLLLDKKY    281 - 350
ALPYRVLDALVFHFLGFRTEKRELPVLWHQCLLTLVQRYKADLATDQKEALLELLRLQPHPQLSPEIRRE    351 - 420
LQSAVPRDVEDVPITVE                                                         421 - 437
//

Text Mined References (36)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20805244 2011 Analysis of two human pre-ribosomal factors, bystin and hTsr1, highlights differences in evolution of ribosome biogenesis between yeast and mammals.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19862010 2009 Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium.
19820697 2009 A genome-wide meta-analysis identifies 22 loci associated with eight hematological parameters in the HaemGen consortium.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17917702 2008 The role of bystin in embryo implantation and in ribosomal biogenesis.
17381424 2007 Bystin in human cancer cells: intracellular localization and function in ribosome biogenesis.
17360433 2007 Trophoblast cell activation by trophinin ligation is implicated in human embryo implantation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14633596 2003 Implantation-dependent expression of trophinin by maternal fallopian tube epithelia during tubal pregnancies: possible role of human chorionic gonadotrophin on ectopic pregnancy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10026108 1999 Expression of trophinin, tastin, and bystin by trophoblast and endometrial cells in human placenta.
9925933 1998 Assignment1 of the bystin gene BYSL to human chromosome band 6p21.1 by in situ hybridization.
9560222 1998 A cytoplasmic protein, bystin, interacts with trophinin, tastin, and cytokeratin and may be involved in trophinin-mediated cell adhesion between trophoblast and endometrial epithelial cells.