Property Summary

NCBI Gene PubMed Count 32
PubMed Score 10.74
PubTator Score 5.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.700 4.3e-04

Gene RIF (8)

PMID Text
26634697 When the inter-dependence between alleles was examined using conditional models, five loci on BUD13, ZNF259, and ApoA5 showed possible independent associations.
26397108 Single nucleotide polymorphisms (Rs17119975) of BUD13 protein did not increase the risk of CHD in the Chinese population.
25900265 Common SNPs within the BUD13-APOA5 gene region can effect triglyceride and LDL cholesterol response to statin therapy.
24989072 Significant linkage disequilibria were noted among ZNF259, BUD13 and MLXIPL SNPs and serum lipid levels.
24780069 Single nucleotide polymorphism bud13 gene is associated with hyperlipidaemia.
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20442857 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19656773 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAAPPLSKAEYLKRYLSGADAGVDRGSESGRKRRKKRPKPGGAGGKGMRIVDDDVSWTAISTTKLEKEE      1 - 70
EEDDGDLPVVAEFVDERPEEVKQMEAFRSSAKWKLLGGHNEDLPSNRHFRHDTPDSSPRRVRHGTPDPSP     71 - 140
RKDRHDTPDPSPRRARHDTPDPSPLRGARHDSDTSPPRRIRHDSSDTSPPRRARHDSPDPSPPRRPQHNS    141 - 210
SGASPRRVRHDSPDPSPPRRARHGSSDISSPRRVHNNSPDTSRRTLGSSDTQQLRRARHDSPDLAPNVTY    211 - 280
SLPRTKSGKAPERASSKTSPHWKESGASHLSFPKNSKYEYDPDISPPRKKQAKSHFGDKKQLDSKGDCQK    281 - 350
ATDSDLSSPRHKQSPGHQDSDSDLSPPRNRPRHRSSDSDLSPPRRRQRTKSSDSDLSPPRRSQPPGKKAA    351 - 420
HMYSGAKTGLVLTDIQREQQELKEQDQETMAFEAEFQYAETVFRDKSGRKRNLKLERLEQRRKAEKDSER    421 - 490
DELYAQWGKGLAQSRQQQQNVEDAMKEMQKPLARYIDDEDLDRMLREQEREGDPMANFIKKNKAKENKNK    491 - 560
KVRPRYSGPAPPPNRFNIWPGYRWDGVDRSNGFEQKRFARLASKKAVEELAYKWSVEDM               561 - 619
//

Text Mined References (45)

PMID Year Title
26634697 2016 Multiple susceptibility loci at chromosome 11q23.3 are associated with plasma triglyceride in East Asians.
26397108 2015 Effects of Polymorphisms in APOA4-APOA5-ZNF259-BUD13 Gene Cluster on Plasma Levels of Triglycerides and Risk of Coronary Heart Disease in a Chinese Han Population.
25900265 2015 Differential Lipid Response to Statins Is Associated With Variants in the BUD13-APOA5 Gene Region.
25416956 2014 A proteome-scale map of the human interactome network.
25240745 2014 A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24989072 2014 Association between the MLX interacting protein-like, BUD13 homolog and zinc finger protein 259 gene polymorphisms and serum lipid levels.
24886709 2014 Amerindian-specific regions under positive selection harbour new lipid variants in Latinos.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24780069 2014 Association of the variants in the BUD13-ZNF259 genes and the risk of hyperlipidaemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24023261 2013 THOC5: a novel gene involved in HDL-cholesterol metabolism.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22437554 2012 Genome-wide association study identifies three common variants associated with serologic response to vitamin E supplementation in men.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21909109 2011 Large-scale genome-wide association studies in East Asians identify new genetic loci influencing metabolic traits.
21729881 2011 Genome-wide association study identifies common variants associated with circulating vitamin E levels.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21386085 2011 A bivariate genome-wide approach to metabolic syndrome: STAMPEED consortium.
21160409 2011 Common human genetic variants and HIV-1 susceptibility: a genome-wide survey in a homogeneous African population.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20838585 2010 Longitudinal genome-wide association of cardiovascular disease risk factors in the Bogalusa heart study.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20442857 2010 Genome-wide association study of Lp-PLA(2) activity and mass in the Framingham Heart Study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19656773 2009 A polygenic basis for four classical Fredrickson hyperlipoproteinemia phenotypes that are characterized by hypertriglyceridemia.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18193046 2008 Genome-wide scan identifies variation in MLXIPL associated with plasma triglycerides.
18193044 2008 Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15565172 2004 Proteomic analysis identifies a new complex required for nuclear pre-mRNA retention and splicing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.