Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.65
PubTator Score 2.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma -3.743 4.3e-04
atypical teratoid / rhabdoid tumor -1.500 1.1e-04
glioblastoma -1.700 1.0e-03
medulloblastoma, large-cell -1.500 5.2e-04
non-small cell lung cancer -3.521 2.6e-30
intraductal papillary-mucinous carcinoma... 1.200 3.6e-02
intraductal papillary-mucinous neoplasm ... 1.200 4.6e-02
active ulcerative colitis 1.220 3.8e-02
breast carcinoma -2.000 4.2e-23
fibroadenoma -2.400 5.3e-03
Breast cancer -3.700 2.2e-02
lung adenocarcinoma -2.400 1.0e-22
adult high grade glioma -1.700 3.5e-05
group 3 medulloblastoma 1.400 1.1e-02
psoriasis -1.500 2.7e-08
Endometriosis -2.452 9.5e-03
lung carcinoma -1.600 5.0e-10
ductal carcinoma in situ -3.200 5.6e-05
invasive ductal carcinoma -4.100 3.1e-05

AA Sequence

MVDLSVSPDSLKPVSLTSSLVFLMHLLLLQPGEPSSEVKVLGPEYPILALVGEEVEFPCHLWPQLDAQQM      1 - 70
EIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQLHSIIPSDKGTYGCRFHSDNF     71 - 140
SGEALWELEVAGLGSDPHLSLEGFKEGGIQLRLRSSGWYPKPKVQWRDHQGQCLPPEFEAIVWDAQDLFS    141 - 210
LETSVVVRAGALSNVSVSIQNLLLSQKKELVVQIADVFVPGASAWKSAFVATLPLLLVLAALALGVLRKQ    211 - 280
RRSREKLRKQAEKRQEKLTAELEKLQTELDWRRAEGQAEWRAAQKYAVDVTLDPASAHPSLEVSEDGKSV    281 - 350
SSRGAPPGPAPGHPQRFSEQTCALSLERFSAGRHYWEVHVGRRSRWFLGACLAAVPRAGPARLSPAAGYW    351 - 420
VLGLWNGCEYFVLAPHRVALTLRVPPRRLGVFLDYEAGELSFFNVSDGSHIFTFHDTFSGALCAYFRPRA    421 - 490
HDGGEHPDPLTICPLPVRGTGVPEENDSDTWLQPYEPADPALDWW                             491 - 535
//

Text Mined References (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.