Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.16
PubTator Score 3.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
nephrosclerosis 1.157 6.2e-04
cutaneous lupus erythematosus 1.500 3.0e-04
psoriasis -1.200 2.2e-02
astrocytoma 1.400 5.9e-12
glioblastoma multiforme 1.600 9.9e-17
oligodendroglioma 1.300 2.8e-08
osteosarcoma -2.123 6.0e-06
posterior fossa group A ependymoma 1.800 2.5e-07
medulloblastoma, large-cell -1.500 4.2e-04
juvenile dermatomyositis 1.542 1.5e-08
non-small cell lung cancer -1.051 3.9e-08
lung cancer -2.700 5.9e-05
active Crohn's disease 2.119 1.9e-03
ulcerative colitis 2.100 8.5e-07
interstitial cystitis 1.500 3.7e-03
adult high grade glioma 1.100 7.9e-03
pilocytic astrocytoma 2.500 2.2e-09
primary Sjogren syndrome 2.400 4.9e-07
nasopharyngeal carcinoma 1.100 6.8e-03
lung carcinoma -2.000 1.3e-19
ovarian cancer -2.500 4.7e-08
Gaucher disease type 3 -1.100 9.1e-03
pituitary cancer -1.200 5.4e-04

Gene RIF (1)

PMID Text
25243493 This study identified that CGPs was found to significantly correlate with the differential expression and methylation of genes encoding butyrophilin, subfamily 3, member A3.

AA Sequence

MKMASSLAFLLLNFHVSLFLVQLLTPCSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSS      1 - 70
SLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVE     71 - 140
LKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIM    141 - 210
RGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPWIAALAGTLPISLLLLAGASYFLWRQQKEKIAL    211 - 280
SRETEREREMKEMGYAATEQEISLREKLQEELKWRKIQYMARGEKSLAYHEWKMALFKPADVILDPDTAN    281 - 350
AILLVSEDQRSVQRAEEPRDLPDNPERFEWRYCVLGCENFTSGRHYWEVEVGDRKEWHIGVCSKNVERKK    351 - 420
GWVKMTPENGYWTMGLTDGNKYRALTEPRTNLKLPEPPRKVGIFLDYETGEISFYNATDGSHIYTFPHAS    421 - 490
FSEPLYPVFRILTLEPTALTICPIPKEVESSPDPDLVPDHSLETPLTPGLANESGEPQAEVTSLLLPAHP    491 - 560
GAEVSPSATTNQNHKLQARTEALY                                                  561 - 584
//

Text Mined References (19)

PMID Year Title
25243493 2014 Correlation between DNA methylation and gene expression in the brains of patients with bipolar disorder and schizophrenia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22846996 2012 The molecular basis for modulation of human V?9V?2 T cell responses by CD277/butyrophilin-3 (BTN3A)-specific antibodies.
22767497 2012 Key implication of CD277/butyrophilin-3 (BTN3A) in cellular stress sensing by a major human ?? T-cell subset.
21918970 2011 Differential role for CD277 as a co-regulator of the immune signal in T and NK cells.
20610803 2010 Stimulation of human butyrophilin 3 molecules results in negative regulation of cellular immunity.
20208008 2010 BTN1A1, the mammary gland butyrophilin, and BTN2A2 are both inhibitors of T cell activation.
19946888 2010 Defining the membrane proteome of NK cells.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11170752 2001 The cluster of BTN genes in the extended major histocompatibility complex.
10354554 1999 Structure and evolution of the extended B7 family.
9149941 1997 A 1.1-Mb transcript map of the hereditary hemochromatosis locus.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.