Property Summary

NCBI Gene PubMed Count 19
PubMed Score 3.18
PubTator Score 13.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
nephrosclerosis 1.022 1.2e-03
esophageal adenocarcinoma 1.500 1.8e-02
cutaneous lupus erythematosus 1.300 1.0e-03
astrocytoma 1.700 3.5e-12
glioblastoma 2.400 1.7e-03
oligodendroglioma 1.400 6.6e-07
posterior fossa group A ependymoma 2.100 7.7e-10
limb girdle muscular dystrophy 2I 1.471 1.9e-03
juvenile dermatomyositis 2.303 3.4e-11
tuberculosis 1.100 1.4e-02
intraductal papillary-mucinous adenoma (... 1.200 6.7e-03
lung cancer -2.200 2.1e-05
active Crohn's disease 1.332 7.1e-03
adult high grade glioma 2.100 1.3e-03
pilocytic astrocytoma 3.300 1.0e-11
primary Sjogren syndrome 1.500 1.8e-03
subependymal giant cell astrocytoma 2.120 1.2e-03
lung carcinoma -2.100 1.0e-18
ulcerative colitis 1.300 1.4e-03
ovarian cancer -1.800 7.2e-09

Gene RIF (7)

PMID Text
25928882 BTN3A2 rs9104 was strongly associated with genotype 1 hepatitis C infection.
22966150 Three SNPs in BTN3A2 were associated with schizophrenia, rs12214031, rs9393709 and rs12199613. There was no interaction between these SNPs and HSV-1, CMV or toxoplasma exposure.
22685580 Results suggest that BT3.2 butyrophilin expression by epithelial cells may modulates the intratumoral infiltration of immune cells.
19571809 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19295542 our results identify PRSS16 and BTN3A2, two genes thought to play important roles in regulating the immune response, as potentially novel susceptibility genes for Type I Deabetes.
19295542 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKMASSLAFLLLNFHVSLLLVQLLTPCSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSS      1 - 70
SLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVE     71 - 140
LKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIM    141 - 210
RGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPWIAALAGTLPILLLLLAGASYFLWRQQKEITAL    211 - 280
SSEIESEQEMKEMGYAATEREISLRESLQEELKRKKIQYLTRGEESSSDTNKSA                    281 - 334
//

Text Mined References (21)

PMID Year Title
25928882 Fine-mapping butyrophilin family genes revealed several polymorphisms influencing viral genotype selection in hepatitis C infection.
22966150 2012 Evaluation of HLA polymorphisms in relation to schizophrenia risk and infectious exposure.
22846996 2012 The molecular basis for modulation of human V?9V?2 T cell responses by CD277/butyrophilin-3 (BTN3A)-specific antibodies.
22767497 2012 Key implication of CD277/butyrophilin-3 (BTN3A) in cellular stress sensing by a major human ?? T-cell subset.
22685580 2012 BTN3A2 expression in epithelial ovarian cancer is associated with higher tumor infiltrating T cells and a better prognosis.
21918970 2011 Differential role for CD277 as a co-regulator of the immune signal in T and NK cells.
21113407 2010 CD277 is a negative co-stimulatory molecule universally expressed by ovarian cancer microenvironmental cells.
20610803 2010 Stimulation of human butyrophilin 3 molecules results in negative regulation of cellular immunity.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19571809 2009 Common variants on chromosome 6p22.1 are associated with schizophrenia.
19295542 2009 Reproducible association with type 1 diabetes in the extended class I region of the major histocompatibility complex.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12124930 2002 A proteomic approach to evaluate the butyrophilin gene family expression in human milk fat globule membrane.
11170752 2001 The cluster of BTN genes in the extended major histocompatibility complex.
9382921 1997 Cloning, localization, and structure of new members of the butyrophilin gene family in the juxta-telomeric region of the major histocompatibility complex.
9149941 1997 A 1.1-Mb transcript map of the hereditary hemochromatosis locus.