Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.49
PubTator Score 10.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.700 9.3e-07
psoriasis 1.200 2.6e-03
osteosarcoma -1.941 8.4e-07
lung cancer -1.100 8.7e-03
interstitial cystitis 1.700 3.2e-04
group 4 medulloblastoma 1.100 8.4e-03
pilocytic astrocytoma 1.100 7.9e-05
posterior fossa group B ependymoma 1.100 1.1e-04
primary Sjogren syndrome 1.100 2.6e-02
ovarian cancer -1.200 7.3e-07

Gene RIF (1)

PMID Text
26809444 Genes encoding butyrophilin-2A2 (BTN2A2) are regulated by the class II trans-activator and regulatory factor X, two transcription factors dedicated to major histocompatibility complex class II expression, suggesting a role in T cell immunity.

AA Sequence

MEPAAALHFSLPASLLLLLLLLLLSLCALVSAQFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRW      1 - 70
FRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEA     71 - 140
ILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTA    141 - 210
VIIRDKYVRNVSCSVNNTLLGQEKETVIFIPESFMPSASPWMVALAVILTASPWMVSMTVILAVFIIFMA    211 - 280
VSICCIKKLQREKKILSGEKKVEQEEKEIAQQLQEELRWRRTFLHAADVVLDPDTAHPELFLSEDRRSVR    281 - 350
RGPYRQRVPDNPERFDSQPCVLGWESFASGKHYWEVEVENVMVWTVGVCRHSVERKGEVLLIPQNGFWTL    351 - 420
EMFGNQYRALSSPERILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSAFTVPVRPFFRLGSDD    421 - 490
SPIFICPALTGASGVMVPEEGLKLHRVGTHQSL                                         491 - 523
//

Text Mined References (13)

PMID Year Title
26809444 2016 Btn2a2, a T cell immunomodulatory molecule coregulated with MHC class II genes.
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19571809 2009 Common variants on chromosome 6p22.1 are associated with schizophrenia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12124930 2002 A proteomic approach to evaluate the butyrophilin gene family expression in human milk fat globule membrane.
11170752 2001 The cluster of BTN genes in the extended major histocompatibility complex.
10354554 1999 Structure and evolution of the extended B7 family.
9149941 1997 A 1.1-Mb transcript map of the hereditary hemochromatosis locus.