Property Summary

NCBI Gene PubMed Count 19
PubMed Score 23.10
PubTator Score 23.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
juvenile dermatomyositis 1189 3.1e-11
ovarian cancer 8491 5.0e-08
glioblastoma 5572 1.1e-03
dermatomyositis 966 2.3e-03
primary Sjogren syndrome 788 1.5e-02
Disease Target Count Z-score Confidence
Ankylosing spondylitis 138 0.0 1.0
Disease Target Count Z-score Confidence
Myocardial Infarction 126 3.68 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.200 1.1e-03
juvenile dermatomyositis 1.053 3.1e-11
primary Sjogren syndrome 1.100 1.5e-02
ovarian cancer -1.300 5.0e-08
dermatomyositis 1.200 2.3e-03

Gene RIF (10)

PMID Text
24452779 A comparison of the allele frequencies or genotype distributions by the chi2 test revealed that rs6929846 of BTN2A1 was significantly associated with dyslipidemia.
22576629 Genetic variants of APOA5 and BTN2A1 may synergistically affect the prevalence of dyslipidemia in East Asian populations and of metabolic syndrome in Japanese individuals.
21784758 Genotype distributions and allele frequencies of the C/T polymorphism (rs6929846) were significantly associated with metabolic syndrome in Japanese subjects, but not in the Korean population.
21672009 BTN2A1 may be a susceptibility gene for Type 2 diabetes in Japanese individuals
21557786 Results suggest that BTN2A1 may be a susceptibility gene for chronic kidney disease in Japanese individuals.
21525964 BTN2A1 may be a susceptibility gene for hypertension in Japanese individuals, with the T allele being related to high blood pressure.
21468600 The relationship between rs6929846 of BTN2A1 or rs2569512 of ILF3 and myocardial infarction is influenced by the serum concentrations of high density lipoprotein cholesterol and low density lipoprotein cholesterol, respectively.
21347509 associations of rs6929846 of butyrophilin subfamily 2 member A1 to myocardial infarction among individuals stratified by the absence or presence of hypertension, diabetes mellitus and chronic kidney disease
21211798 BTN2A1 may be a susceptibility gene for myocardial infarction in Japanese individuals.
17785817 Rather than interacting with T cells, butyrophilin BTN2A1 is recognized by DC-SIGN on immature monocyte-derived dendritic cells.

AA Sequence

MESAAALHFSRPASLLLLLLSLCALVSAQFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQ      1 - 70
FSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCYFQEGRSYDEAILHL     71 - 140
VVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVAPALKEVSMPDADGLFMVTTAVIIR    141 - 210
DKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSPCAVALPIIVVILMIPIAVCIYWINKLQKEKKILS    211 - 280
GEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAVDVVLDPDTAHPDLFLSEDRRSV    281 - 350
RRCPFRHLGESVPDNPERFDSQPCVLGRESFASGKHYWEVEVENVIEWTVGVCRDSVERKGEVLLIPQNG    351 - 420
FWTLEMHKGQYRAVSSPDRILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSAFSVPVRPFFRL    421 - 490
GCEDSPIFICPALTGANGVTVPEEGLTLHRVGTHQSL                                     491 - 527
//

Text Mined References (22)

PMID Year Title
24452779 2014 Association of a polymorphism of BTN2A1 with dyslipidemia in community-dwelling individuals.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22576629 2012 Synergistic effects of genetic variants of APOA5 and BTN2A1 on dyslipidemia or metabolic syndrome.
21784758 2011 Association of a genetic variant of BTN2A1 with metabolic syndrome in East Asian populations.
21672009 2011 Association of a polymorphism of BTN2A1 with type 2 diabetes mellitus in Japanese individuals.
21557786 2011 Association of a genetic variant of BTN2A1 with chronic kidney disease in Japanese individuals.
21525964 2011 Association of a polymorphism of BTN2A1 with hypertension in Japanese individuals.
21468600 Association of polymorphisms of BTN2A1 and ILF3 with myocardial infarction in Japanese individuals with different lipid profiles.
21347509 2011 Association of polymorphisms of BTN2A1 and ILF3 with myocardial infarction in Japanese individuals with or without hypertension, diabetes mellitus or chronic kidney disease.
21211798 2011 Association of a polymorphism of BTN2A1 with myocardial infarction in East Asian populations.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17785817 2007 The B7 homolog butyrophilin BTN2A1 is a novel ligand for DC-SIGN.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11170752 2001 The cluster of BTN genes in the extended major histocompatibility complex.
9382921 1997 Cloning, localization, and structure of new members of the butyrophilin gene family in the juxta-telomeric region of the major histocompatibility complex.
9149941 1997 A 1.1-Mb transcript map of the hereditary hemochromatosis locus.