Property Summary

NCBI Gene PubMed Count 20
PubMed Score 80.09
PubTator Score 28.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Ankylosing spondylitis 138 0.0 1.0
Iron metabolism disease 17 0.0 2.0
Disease Target Count Z-score Confidence
Batten disease 15 5.009 2.5

Expression

Gene RIF (2)

PMID Text
21915327 Data illustrated the importance of Akt1 in mammary epithelial cell proliferation, as well as in the regulation of Btn1a1 and subsequent expression of ss-casein.
19531472 PRY/SPRY/B30.2 domain of butyrophilin 1A1 (BTN1A1) binds to xanthine oxidoreductase

AA Sequence

MAVFPSSGLPRCLLTLILLQLPKLDSAPFDVIGPPEPILAVVGEDAELPCRLSPNASAEHLELRWFRKKV      1 - 70
SPAVLVHRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVSDDGEYTCFFREDGSYEEALVHLK     71 - 140
VAALGSDPHISMQVQENGEICLECTSVGWYPEPQVQWRTSKGEKFPSTSESRNPDEEGLFTVAASVIIRD    141 - 210
TSAKNVSCYIQNLLLGQEKKVEISIPASSLPRLTPWIVAVAVILMVLGLLTIGSIFFTWRLYNERPRERR    211 - 280
NEFSSKERLLEELKWKKATLHAVDVTLDPDTAHPHLFLYEDSKSVRLEDSRQKLPEKTERFDSWPCVLGR    281 - 350
ETFTSGRHYWEVEVGDRTDWAIGVCRENVMKKGFDPMTPENGFWAVELYGNGYWALTPLRTPLPLAGPPR    351 - 420
RVGIFLDYESGDISFYNMNDGSDIYTFSNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQD    421 - 490
LSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGAP                                      491 - 526
//

Text Mined References (21)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
23722424 2013 GWAS of 126,559 individuals identifies genetic variants associated with educational attainment.
21915327 2011 Akt1 is essential for postnatal mammary gland development, function, and the expression of Btn1a1.
19531472 2009 The PRY/SPRY/B30.2 domain of butyrophilin 1A1 (BTN1A1) binds to xanthine oxidoreductase: implications for the function of BTN1A1 in the mammary gland and other tissues.
19084217 2009 Variants in TF and HFE explain approximately 40% of genetic variation in serum-transferrin levels.
18780401 2008 Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16498413 2006 Structural and functional insights into the B30.2/SPRY domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456835 2002 Functional regulation of xanthine oxidoreductase expression and localization in the mouse mammary gland: evidence of a role in lipid secretion.
11170752 2001 The cluster of BTN genes in the extended major histocompatibility complex.
10429365 1999 Cloning, expression analysis, and chromosomal localization of a novel butyrophilin-like receptor.
10376248 1999 Multiple forms of lactadherin (breast antigen BA46) and butyrophilin are secreted into human milk as major components of milk fat globule membrane.
9382921 1997 Cloning, localization, and structure of new members of the butyrophilin gene family in the juxta-telomeric region of the major histocompatibility complex.
8611614 1996 Cloning and sequence analysis of human butyrophilin reveals a potential receptor function.
8132890 1993 A review of the molecular and cellular biology of butyrophilin, the major protein of bovine milk fat globule membrane.
8114113 1993 Evolutionary study of multigenic families mapping close to the human MHC class I region.
7775382 1995 Site-specific glycosylation of bovine butyrophilin.
6830779 1983 Butyrophilin, an apical plasma membrane-associated glycoprotein characteristic of lactating mammary glands of diverse species.