Property Summary

NCBI Gene PubMed Count 21
PubMed Score 97.65
PubTator Score 36.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.762 9.5e-03
glioblastoma 2.000 6.2e-04
ependymoma 1.100 1.6e-06
sonic hedgehog group medulloblastoma 1.500 1.0e-04
atypical teratoid / rhabdoid tumor 1.200 3.0e-05
primitive neuroectodermal tumor 1.200 8.4e-03
primary pancreatic ductal adenocarcinoma 1.044 3.2e-02
colon cancer 3.500 2.4e-03
lung cancer -1.400 6.3e-04
pediatric high grade glioma 1.200 1.3e-04
lung carcinoma -1.600 1.4e-21
Breast cancer -1.400 2.2e-04
acute myeloid leukemia 1.700 1.9e-02
ovarian cancer 2.100 1.9e-04
pituitary cancer -1.300 7.3e-03
Down syndrome 1.400 1.0e-03

Synonym

Accession Q14201 D3DSC4 Q53XV1 Q96ET7
Symbols ANA
TOB5
TOFA
APRO4
TOB55

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (11)

PMID Text
25904053 BTG3 overexpression might reverse the aggressive phenotypes and be employed as a potential target for gene therapy of gastric cancer.
25701359 The suppressed migration and invasion abilities found in BTG3-overexpressing esophageal adenocarcinoma cells. Our findings suggested that BTG3 is suppressor in the progression of esophageal adenocarcinoma
25569101 BTG3 binds and suppresses AKT, a kinase frequently deregulated in cancers.
25238703 Down-regulation of BTG3 promotes cell proliferation, migration and invasion in gastric cancer.
23810394 These results disclosed an important role of BTG3 in lung tumorigenesis.
23657964 BTG3 protein expression may be considered as a good marker to indicate the favorable prognosis of epithelial ovarian carcinoma.
23533280 BTG3-dependent CHK1 ubiquitination contributes to its chromatin localization and activation and a defect in this regulation may increase genome instability and promote tumorigenesis
22020331 loss of BTG3 in normal cells induced cellular senescence, which was correlated with enhanced ERK-AP1 signaling and elevated expression of the histone H3K27me3 demethylase JMJD3/KDM6B
19221000 BTG3 is epigenetically silenced in renal cancer
18590053 These data support the hypothesis that BTG3 may act to suppress tumorigenesis and that hypermethylation is an important mechanism for inactivation of BTG3 and perhaps other tumor suppressor genes.
17690688 by disrupting the DNA binding activity of E2F1, BTG3 participates in the regulation of E2F1 target gene expression. Therefore, our studies have revealed a previously unidentified pathway through which the activity of E2F1 may be guarded by activated p53.

AA Sequence

MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTLILQEKYKNHWYPEKPSKGQAYRCIRVNKFQRVDP      1 - 70
DVLKACENSCILYSDLGLPKELTLWVDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTS     71 - 140
DYHSGSSSSDEETSKEMEVKPSSVTAAASPVYQISELIFPPLPMWHPLPRKKPGMYRGNGHQNHYPPPVP    141 - 210
FGYPNQGRKNKPYRPIPVTWVPPPGMHCDRNHWINPHMLAPH                                211 - 252
//

Text Mined References (21)

PMID Year Title
25904053 2015 The roles of BTG3 expression in gastric cancer: a potential marker for carcinogenesis and a target molecule for gene therapy.
25701359 2015 BTG3 upregulation induces cell apoptosis and suppresses invasion in esophageal adenocarcinoma.
25569101 2015 Candidate tumor suppressor B-cell translocation gene 3 impedes neoplastic progression by suppression of AKT.
25238703 2015 Down-regulation of BTG3 promotes cell proliferation, migration and invasion and predicts survival in gastric cancer.
23810394 2013 Downregulation of BTG3 in non-small cell lung cancer.
23657964 2013 Decreased expression of BTG3 was linked to carcinogenesis, aggressiveness, and prognosis of ovarian carcinoma.
23533280 2013 Candidate tumor suppressor BTG3 maintains genomic stability by promoting Lys63-linked ubiquitination and activation of the checkpoint kinase CHK1.
22020331 2012 Loss of the candidate tumor suppressor BTG3 triggers acute cellular senescence via the ERK-JMJD3-p16(INK4a) signaling axis.
19221000 2009 BTG3 tumor suppressor gene promoter demethylation, histone modification and cell cycle arrest by genistein in renal cancer.
18590053 2008 Methylation-mediated downregulation of the B-cell translocation gene 3 (BTG3) in breast cancer cells.
17690688 2007 The candidate tumor suppressor BTG3 is a transcriptional target of p53 that inhibits E2F1.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11429045 2001 Association of ANA, a member of the antiproliferative Tob family proteins, with a Caf1 component of the CCR4 transcriptional regulatory complex.
11377414 2001 In search of a function for the TIS21/PC3/BTG1/TOB family.
10940556 2000 Identification and molecular analysis of BANP.
10830953 2000 The DNA sequence of human chromosome 21.
9632145 1998 ANA, a novel member of Tob/BTG1 family, is expressed in the ventricular zone of the developing central nervous system.
9067576 1997 Cloning of the mouse BTG3 gene and definition of a new gene family (the BTG family) involved in the negative control of the cell cycle.