Property Summary

NCBI Gene PubMed Count 24
PubMed Score 117.62
PubTator Score 36.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute myeloid leukemia 1.700 1.9e-02
atypical teratoid / rhabdoid tumor 1.100 7.6e-05
Breast cancer -1.400 2.2e-04
colon cancer 3.500 2.4e-03
Down syndrome 1.400 1.0e-03
ependymoma 1.100 1.6e-06
glioblastoma 1.100 8.3e-06
lung cancer -1.300 1.1e-04
lung carcinoma -1.600 1.4e-21
medulloblastoma 1.100 2.0e-04
Multiple myeloma 1.762 9.5e-03
ovarian cancer 2.100 1.9e-04
pediatric high grade glioma 1.200 1.3e-04
pituitary cancer -1.200 1.6e-02
primary pancreatic ductal adenocarcinoma 1.044 3.2e-02
primitive neuroectodermal tumor 1.100 2.1e-02

Gene RIF (14)

AA Sequence

MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTLILQEKYKNHWYPEKPSKGQAYRCIRVNKFQRVDP      1 - 70
DVLKACENSCILYSDLGLPKELTLWVDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTS     71 - 140
DYHSGSSSSDEETSKEMEVKPSSVTAAASPVYQISELIFPPLPMWHPLPRKKPGMYRGNGHQNHYPPPVP    141 - 210
FGYPNQGRKNKPYRPIPVTWVPPPGMHCDRNHWINPHMLAPH                                211 - 252
//

Text Mined References (24)

PMID Year Title