Property Summary

NCBI Gene PubMed Count 44
PubMed Score 0.92
PubTator Score 51.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Multiple myeloma 1.556 1.1e-02
malignant mesothelioma -1.800 5.5e-07
astrocytoma 1.900 9.2e-04
glioblastoma 2.600 1.6e-04
oligodendroglioma 1.500 3.1e-16
osteosarcoma 1.957 7.7e-06
medulloblastoma 1.200 8.2e-04
primitive neuroectodermal tumor 1.400 7.9e-03
Duchenne muscular dystrophy 1.796 1.1e-06
limb girdle muscular dystrophy 2I 1.105 7.2e-03
autosomal dominant Emery-Dreifuss muscul... 1.754 3.5e-03
juvenile dermatomyositis 2.063 2.1e-12
Amyotrophic Lateral Sclerosis 1.204 3.4e-04
acute quadriplegic myopathy 2.025 1.2e-05
diabetes mellitus -1.200 2.3e-02
lung adenocarcinoma -1.500 1.0e-11
Pick disease 1.300 2.1e-04
ovarian cancer 2.700 2.9e-08
dermatomyositis 1.800 8.9e-05

Synonym

Accession P62324 P31607
Symbols APRO2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (26)

PMID Text
26503430 our data suggest that BTG1 overexpression combined with radiation therapy increases the therapeutic efficacy of breast cancer treatment via regulation of the cell cycle and apoptosis-related signaling pathways.
26050197 Suggest that down-regulated BTG1 expression might promote gastric carcinogenesis partially due to its promoter methylation. BTG1 overexpression might reverse the aggressive phenotypes.
25936765 Data indicate that microRNA-19a regulates prostate cancer cells by directly targeting B cell translocation gene-1 protein BTG1.
25487193 Altered expression of BTG1 is a potential biomarker for carcinogenesis and progression of gastric cancer, particularly for proximal nondiffuse and diffuse GC.
25405901 Our results indicate that altered BTG1 expression might affect hepatocarcinogenesis and may represent a novel biomarker for HCC carcinogenesis and progression.
25173640 BTG1 protein levels were significantly reduced in hepatocellular cancer and were associated with lymph node metastasis, clinical stage, cell differentiation, and prognosis.
25115181 Down-regulation of BTG1 by miR-454-3p renders tumor cells sensitive to radiation.
25017022 Results show that reduced BTG1 expression is associated with increased disease severity, suggesting it as negative regulator of thyroid cancer.
24998463 BTG1 deletions might play a role in leukemogenesis of B-cell precursor acute lymphoblastic leukemia as well as of BCR-ABL1-positive mixed-phenotype acute leukemia and chronic myeloid leukemia in B-lineage blast crisis (B-lineage).
24985971 Reduced BTG1 expression is associated with increased nasopharyngeal cancer severity, suggesting it is a negative regulator of the cancer and can serve as a prognostic indicator. Reduced BTG1 expression is possibly associated with tumour metastasis.
24969561 Reduced BTG1 expression is associated with increased disease severity, suggesting it is a negative regulator of esophageal cancer
24714932 Bcell translocation 1 gene inhibits cellular metastasisassociated behavior in breast cancer.
24272202 BTG1 may play important roles as a negative regulator to breast cancer cell.
24264312 BTG1 expression decreased in nonsmall cell lung cancer and correlated significantly with lymph node metastasis; clinical stage; histological grade; poor overall survival
24084718 Altered BTG1 expression might play a role in the pathogenesis.
23982470 These results indicate that BTG1 may be used as a novel therapeutic target for human breast cancer treatment.
22868968 BTG1 deletions are not associated with down syndrome acute lymphoblastic leukemia
22072402 BTG1 loss is a novel finding in acute lymphoblastic leukemia in children with down syndrome
20354172 BTG1 regulates glucocorticoid receptor autoinduction in acute lymphoblastic leukemia.
19515430 These findings support the hypothesis that BTG1 polymorphisms may influence genetic predisposition for MS, especially in relapse-onset MS patients.
19515430 Observational study of gene-disease association. (HuGE Navigator)
18814951 five genes (TNFSF10/TRAIL, IL1RN, IFI27, GZMB, and CCR5) were upregulated and three genes (CLK1, TNFAIP3 and BTG1) were downregulated in at least three out of four subpopulations during acute GVHD.
15674337 BTG1 is a novel important coactivator involved in the regulation of myoblast differentiation.
15033446 BTG1 may play an important role in the process of angiogenesis
14734530 FoxO3a controls expression of BTG1 and subsequent regulation of protein arginine methyl transferase activity.
12135500 Antiproliferative proteins of the BTG/Tob family are degraded by the ubiquitin-proteasome system. the C-terminal regions are necessary and sufficient to control the stabilities of BTG1, BTG2, Tob, and Tob2 proteins.

AA Sequence

MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCI      1 - 70
RINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNV     71 - 140
QMVDSRISCKEELLLGRTSPSKNYNMMTVSG                                           141 - 171
//

Text Mined References (45)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26503430 2015 Upregulation of BTG1 enhances the radiation sensitivity of human breast cancer in vitro and in vivo.
26050197 2015 BTG1 expression correlates with pathogenesis, aggressive behaviors and prognosis of gastric cancer: a potential target for gene therapy.
25936765 2015 MicroRNA-19a regulates proliferation and apoptosis of castration-resistant prostate cancer cells by targeting BTG1.
25487193 2015 Diversity of clinical implication of B-cell translocation gene 1 expression by histopathologic and anatomic subtypes of gastric cancer.
25405901 2015 B?cell translocation gene 1 serves as a novel prognostic indicator of hepatocellular carcinoma.
25173640 2014 Expression of BTG1 in hepatocellular carcinoma and its correlation with cell cycles, cell apoptosis, and cell metastasis.
25115181 2014 Down-regulation of BTG1 by miR-454-3p enhances cellular radiosensitivity in renal carcinoma cells.
25017022 2014 BTG1 expression in thyroid carcinoma: diagnostic indicator and prognostic marker.
24998463 2014 High frequency of BTG1 deletions in patients with BCR-ABL1-positive acute leukemia.
24985971 2014 The expression of BTG1 is downregulated in nasopharyngeal carcinoma and possibly associated with tumour metastasis.
24969561 2014 BTG1 underexpression is an independent prognostic marker in esophageal squamous cell carcinoma.
24714932 2014 B?cell translocation 1 gene inhibits cellular metastasis?associated behavior in breast cancer.
24272202 2014 BTG1 expression correlates with the pathogenesis and progression of breast carcinomas.
24264312 2014 The expression of BTG1 is downregulated in NSCLC and possibly associated with tumor metastasis.
24084718 2013 BTG1 expression correlates with the pathogenesis and progression of ovarian carcinomas.
23982470 2013 BTG1 inhibits breast cancer cell growth through induction of cell cycle arrest and apoptosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22868968 2013 BTG1 deletions do not predict outcome in Down syndrome acute lymphoblastic leukemia.
22072402 2012 High frequency of BTG1 deletions in acute lymphoblastic leukemia in children with down syndrome.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
20445134 2010 Association of genome-wide variation with the risk of incident heart failure in adults of European and African ancestry: a prospective meta-analysis from the cohorts for heart and aging research in genomic epidemiology (CHARGE) consortium.
20354172 2010 BTG1 regulates glucocorticoid receptor autoinduction in acute lymphoblastic leukemia.
19515430 2009 Genetic association between polymorphisms in the BTG1 gene and multiple sclerosis.
18814951 2008 Gene-expression profiles of peripheral blood mononuclear cell subpopulations in acute graft-vs-host disease following cord blood transplantation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15674337 2005 Coactivation of nuclear receptors and myogenic factors induces the major BTG1 influence on muscle differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15033446 2004 An anti-proliferative gene BTG1 regulates angiogenesis in vitro.
14734530 2004 FoxO3a regulates erythroid differentiation and induces BTG1, an activator of protein arginine methyl transferase 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12135500 2002 Antiproliferative proteins of the BTG/Tob family are degraded by the ubiquitin-proteasome system.
11856371 2002 Interaction of PRMT1 with BTG/TOB proteins in cell signalling: molecular analysis and functional aspects.
11429045 2001 Association of ANA, a member of the antiproliferative Tob family proteins, with a Caf1 component of the CCR4 transcriptional regulatory complex.
11420681 2001 Identification of functional domains involved in BTG1 cell localization.
11136725 2001 Relationships of the antiproliferative proteins BTG1 and BTG2 with CAF1, the human homolog of a component of the yeast CCR4 transcriptional complex: involvement in estrogen receptor alpha signaling pathway.
10617598 2000 The leukemia-associated protein Btg1 and the p53-regulated protein Btg2 interact with the homeoprotein Hoxb9 and enhance its transcriptional activation.
9820826 1998 Human carbon catabolite repressor protein (CCR4)-associative factor 1: cloning, expression and characterization of its interaction with the B-cell translocation protein BTG1.
9712883 1998 Interaction of BTG1 and p53-regulated BTG2 gene products with mCaf1, the murine homolog of a component of the yeast CCR4 transcriptional regulatory complex.
9690562 1998 Antiproliferative gene BTG1 is highly expressed in apoptotic cells in macrophage-rich areas of advanced lesions in Watanabe heritable hyperlipidemic rabbit and human.
8663146 1996 The mammalian immediate-early TIS21 protein and the leukemia-associated BTG1 protein interact with a protein-arginine N-methyltransferase.
2069907 1991 A chromosome 12 coding region is juxtaposed to the MYC protooncogene locus in a t(8;12)(q24;q22) translocation in a case of B-cell chronic lymphocytic leukemia.
1373383 1992 BTG1, a member of a new family of antiproliferative genes.