Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 8.0e-07
ovarian cancer 8520 9.0e-05
oligodendroglioma 2850 3.1e-04
ependymoma 4679 1.9e-03
astrocytic glioma 2597 6.0e-03

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.200 6.0e-03
ependymoma -1.300 1.9e-03
oligodendroglioma -1.600 3.1e-04
osteosarcoma -1.226 8.0e-07
ovarian cancer -1.200 9.0e-05

AA Sequence

MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFN      1 - 70
NPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDD     71 - 140
DVPDLVENFDEASKNEAN                                                        141 - 158
//

Text Mined References (10)

PMID Year Title