Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.70
PubTator Score 2.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non diabetic and post-ischemic heart failure 200 3.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Gene RIF (1)

AA Sequence

MARCGEGSAAPMVLLGSAGVCSKGLQRKGPCERRRLKATVSEQLSQDLLRLLREEFHTDVTFSVGCTLFK      1 - 70
AHKAVLLARVPDFYFHTIGQTSNSLTNQEPIAVENVEALEFRTFLQIIYSSNRNIKNYEEEILRKKIMEI     71 - 140
GISQKQLDISFPKCENSSDCSLQKHEIPEDISDRDDDFISNDNYDLEPASELGEDLLKLYVKPCCPDIDI    141 - 210
FVDGKRFKAHRAILSARSSYFAAMLSGCWAESSQEYVTLQGISHVELNVMMHFIYGGTLDIPDKTNVGQI    211 - 280
LNMADMYGLEGLKEVAIYILRRDYCNFFQKPVPRTLTSILECLIIAHSVGVESLFADCMKWIVKHFARFW    281 - 350
SERSFANIPPEIQKSCLNMLIQSLVSIT                                              351 - 378
//

Text Mined References (6)

PMID Year Title