Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.75
PubTator Score 3.08

Knowledge Summary


No data available


  Differential Expression (22)

Disease log2 FC p
Multiple myeloma 3.130 2.4e-03
astrocytic glioma -1.300 3.0e-02
posterior fossa group A ependymoma -1.900 5.0e-10
oligodendroglioma -1.300 3.0e-02
cutaneous lupus erythematosus -1.100 5.1e-03
psoriasis 1.600 1.6e-04
osteosarcoma 1.154 3.5e-03
glioblastoma -1.900 1.8e-04
atypical teratoid / rhabdoid tumor -1.400 2.0e-03
group 4 medulloblastoma -1.700 6.1e-05
medulloblastoma, large-cell -1.900 4.4e-06
primitive neuroectodermal tumor -1.100 1.5e-02
tuberculosis and treatment for 6 months 1.300 3.2e-04
intraductal papillary-mucinous carcinoma... 1.200 3.7e-02
colon cancer -2.600 4.6e-03
lung cancer 1.900 1.3e-04
adult high grade glioma -1.800 3.3e-04
pilocytic astrocytoma -1.400 2.5e-05
subependymal giant cell astrocytoma -2.885 2.7e-02
ulcerative colitis -1.100 4.7e-06
ovarian cancer 1.800 6.5e-03
dermatomyositis 1.500 1.4e-03


Accession Q9Y2F9 D3DW19 Q5JY73
Symbols dJ742J24.1


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

21720722 BTBD3 is repressed by miR-9 and -181c, either alone or in combination.
20463552 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

CGKVTVQFQCSSDSTNGTGVQGGQIPELIFYA                                          491 - 522

Text Mined References (12)

PMID Year Title
25060954 2014 Salt-inducible kinase 3, SIK3, is a new gene associated with hearing.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21720722 2012 Target gene repression mediated by miRNAs miR-181c and miR-9 both of which are down-regulated by amyloid-?.
21348951 2011 Hypertrophy-associated polymorphisms ascertained in a founder cohort applied to heart failure risk and mortality.
20463552 2010 Genome-wide examination of genetic variants associated with response to platinum-based chemotherapy in patients with small-cell lung cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.