Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.25
PubTator Score 5.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.500 1.3e-03
ependymoma -1.300 6.2e-12
osteosarcoma -1.195 3.8e-05
atypical teratoid / rhabdoid tumor -1.500 8.3e-07
glioblastoma -1.500 3.5e-06
medulloblastoma -1.400 1.1e-06
medulloblastoma, large-cell -1.900 9.1e-05
primary pancreatic ductal adenocarcinoma 1.374 1.3e-03
intraductal papillary-mucinous neoplasm ... 1.900 3.6e-02
Breast cancer 2.500 2.9e-02
adult high grade glioma -1.200 8.3e-04
pilocytic astrocytoma -1.100 1.9e-05

Synonym

Accession Q9BSF8 B7Z228 Q86WG1
Symbols GMRP1
GMRP-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
23320755 findings suggest that reduced BTBD10 expression is closely linked to the pathogenesis of sporadic amyotrophic lateral sclerosis
22388351 Collectively, these results suggest that the reduced expression of BTBD10 leads to motor neuron death both in vitro and in vivo.
21267538 GMRP1 regulates pancreatic beta cell proliferation and apoptosis via activation of Akt signalling pathway.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18160256 BTBD10 appears to behave as a suppressor of cell death including neuronal cell death related to amyotrophic lateral sclerosis and an enhancer of cell growth via its positive regulation of Akt phosphorylation.

AA Sequence

MAGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSLHGASGGHERSRDRRRSSDR      1 - 70
SRDSSHERTESQLTPCIRNVTSPTRQHHVEREKDHSSSRPSSPRPQKASPNGSISSAGNSSRNSSQSSSD     71 - 140
GSCKTAGEMVFVYENAKEGARNIRTSERVTLIVDNTRFVVDPSIFTAQPNTMLGRMFGSGREHNFTRPNE    141 - 210
KGEYEVAEGIGSTVFRAILDYYKTGIIRCPDGISIPELREACDYLCISFEYSTIKCRDLSALMHELSNDG    211 - 280
ARRQFEFYLEEMILPLMVASAQSGERECHIVVLTDDDVVDWDEEYPPQMGEEYSQIIYSTKLYRFFKYIE    281 - 350
NRDVAKSVLKERGLKKIRLGIEGYPTYKEKVKKRPGGRPEVIYNYVQRPFIRMSWEKEEGKSRHVDFQCV    351 - 420
KSKSITNLAAAAADIPQDQLVVMHPTPQVDELDILPIHPPSGNSDLDPDAQNPML                   421 - 475
//

Text Mined References (14)

PMID Year Title
23320755 2013 Reduced expression of BTBD10 in anterior horn cells with Golgi fragmentation and pTDP-43-positive inclusions in patients with sporadic amyotrophic lateral sclerosis.
22388351 2012 Reduced expression of BTBD10, an Akt activator, leads to motor neuron death.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21267538 2011 Glucose metabolism-related protein 1 (GMRP1) regulates pancreatic beta cell proliferation and apoptosis via activation of Akt signalling pathway in rats and mice.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18160256 2008 A novel Akt/PKB-interacting protein promotes cell adhesion and inhibits familial amyotrophic lateral sclerosis-linked mutant SOD1-induced neuronal death via inhibition of PP2A-mediated dephosphorylation of Akt/PKB.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15556295 2004 Molecular cloning and characterization of a novel human BTB domain-containing gene, BTBD10, which is down-regulated in glioma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.