Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.85
PubTator Score 2.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.189 1.1e-02
atypical teratoid / rhabdoid tumor -1.100 7.5e-04
medulloblastoma -1.100 6.3e-06
ovarian cancer 1.700 2.2e-04

 GWAS Trait (1)

Protein-protein Interaction (10)

Gene RIF (4)

PMID Text
21092135 Interaction of BTBD1 and BTBD2 with TOP1 requires TOP1 residues 236 and 237, the same residues required to enhance the infectivity of progeny virions when TOP1 is expressed in African Green Monkey producer cells.
19460752 Knockdown of BTB (POZ) domain containing 1 (BTBD1; C15orf1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
15486563 BTBD1 is essential for myogenic differentiation
12878161 subcellular colocalization of BTBD1 and BTBD2 to cytoplasmic bodies; TRIM5delta colocalized with BTBD1/2 and appeared to serve as a scaffold for the assembly of endogenous BTBD1/2 proteins

AA Sequence

MASLGPAAAGEQASGAEAEPGPAGPPPPPSPSSLGPLLPLQREPLYNWQATKASLKERFAFLFNSELLSD      1 - 70
VRFVLGKGRGAAAAGGPQRIPAHRFVLAAGSAVFDAMFNGGMATTSAEIELPDVEPAAFLALLRFLYSDE     71 - 140
VQIGPETVMTTLYTAKKYAVPALEAHCVEFLTKHLRADNAFMLLTQARLFDEPQLASLCLDTIDKSTMDA    141 - 210
ISAEGFTDIDIDTLCAVLERDTLSIRESRLFGAVVRWAEAECQRQQLPVTFGNKQKVLGKALSLIRFPLM    211 - 280
TIEEFAAGPAQSGILSDREVVNLFLHFTVNPKPRVEYIDRPRCCLRGKECCINRFQQVESRWGYSGTSDR    281 - 350
IRFTVNRRISIVGFGLYGSIHGPTDYQVNIQIIEYEKKQTLGQNDTGFSCDGTANTFRVMFKEPIEILPN    351 - 420
VCYTACATLKGPDSHYGTKGLKKVVHETPAASKTVFFFFSSPGNNNGTSIEDGQIPEIIFYT            421 - 482
//

Text Mined References (21)

PMID Year Title
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
21326860 2011 Identification of novel susceptibility Loci for kawasaki disease in a Han chinese population by a genome-wide association study.
21092135 2010 Human TOP1 residues implicated in species specificity of HIV-1 infection are required for interaction with BTBD2, and RNAi of BTBD2 in old world monkey and human cells increases permissiveness to HIV-1 infection.
20531441 2010 CAMOS, a nonprogressive, autosomal recessive, congenital cerebellar ataxia, is caused by a mutant zinc-finger protein, ZNF592.
18305892 2008 Search for cellular partners of human papillomavirus type 16 E2 protein.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15486563 2004 The topoisomerase 1-interacting protein BTBD1 is essential for muscle cell differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14528312 2003 Targeting of protein ubiquitination by BTB-Cullin 3-Roc1 ubiquitin ligases.
12878161 2003 BTBD1 and BTBD2 colocalize to cytoplasmic bodies with the RBCC/tripartite motif protein, TRIM5delta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11818025 2002 Characterization of BTBD1 and BTBD2, two similar BTB-domain-containing Kelch-like proteins that interact with Topoisomerase I.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11179693 2001 Identification and characterization of BTBD1, a novel BTB domain containing gene on human chromosome 15q24.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.