Property Summary

NCBI Gene PubMed Count 49
PubMed Score 67.74
PubTator Score 72.74

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -3.100 6.6e-09
psoriasis -1.700 9.6e-05
osteosarcoma -3.455 5.5e-06
cystic fibrosis -1.215 1.8e-04
tuberculosis 3.200 6.8e-08
non-small cell lung cancer -1.107 1.5e-14
fibroadenoma -1.300 7.3e-03
pilocytic astrocytoma 1.300 1.9e-06
lung adenocarcinoma -1.500 3.6e-11
lung carcinoma -1.500 4.7e-19
invasive ductal carcinoma -1.100 6.7e-03
ovarian cancer -1.600 2.7e-07

Gene RIF (30)

PMID Text
25986899 the rs4698412 variant of BST-1 may increase the Parkinson disease susceptibility. [META-ANALYSIS]
25250980 A pre-steady state and steady state kinetic analysis of the N-ribosyl hydrolase activity of hCD157.
24896331 Studies indicate that vertebrate ADP-ribosyl cyclases (ARCs) Bst1 and CD38 with common gene structure of invertebrate ARC, suggesting the origin to the ancestor of bilaterian animals.
24795584 These results demonstrate for the first time that CD157 plays a role as a neuro-regulator and suggest a potential role in pre-motor symptoms in Parkinson's disease.
24753259 These findings indicate a central role of CD157 in cell-extracellular matrix interactions and make CD157 an attractive therapeutic target in inflammation and cancer.
24634087 Autism and with features of regression-previously acquired speech lost in the second year of life. The younger sister, who also had asthma, inherited a maternal deletion of 4p15.32 that results in a BST1-CD38 fusion transcript.
24413464 Novel SCRG1/BST1 axis regulates self-renewal, migration, and osteogenic differentiation potential in mesenchymal stem cells.
24413464 A ligand-receptor complex SCRG1/BST1 axis facilitate mesenchymal stem cells migration, preserve OCT4 and CD271 expression, self-renewal and osteogenic differentiation.
24342025 BST1 rs11724635 polymorphism can interact with well water drinking to increase the risk of Parkinson's disease in a Taiwanese population.
23853107 The results of this study indicated that the SNCA and BST1 SNPs generally increase the risk of developing PD and that SNCA rs11931074 in particular is associated with a higher risk of parkinson disease with family history.
23827523 The results of this study showed that no causative mutation in the BST1 gene in patients with Parkinson's disease.
23820587 This study confirmed the associations of BST1 with parkinson disease susceptibility and fail to show significant associations of alzheimer disease genome-wide association study (GWAS) top hits with PD susceptibility in a Korean population.
23026536 BST1 SNPs rs11931532, rs12645693, & rs11724635 did not correlate with sporadic PD. The relationship of rs11724635 & sporadic PD had borderline significance. Smoking or caffeine intake did not correlate with SNP rs11724635 affecting sporadic PD.
22916288 Findings implicate CD157 in the progression of EOC to metastatic disease and suggest that CD157 may represent a valuable therapeutic target.
22490479 The SNPs investigated in the BST1, PARK15 and PARK9 genes associated with PD susceptibility are not associated with PD in the northern Han Chinese population.
21478153 The CD157-integrin partnership provides optimal adhesion and transmigration of human monocytes.
21248740 Direct replication of single nucleotide polymorphisms (SNPs) within SNCA and BST1 confirmed these two genes to be associated with the Parkinson's Disease in the Netherlands.
21084426 found converging evidence of association with Parkinson's disease on 12q24 (rs4964469, combined P = 2.4 x 10(-7)) and confirmed the association on 4p15/BST1 (rs4698412, combined P = 1.8 x 10(-6)), previously reported in Japanese data
21084426 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
21044948 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20711177 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20697102 PARK16, PARK8, and PARK1 loci but not BST1 are found to be associated with Parkinson's disease.
20697102 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20639476 CD157 plays a pivotal role in the control of ovarian cancer cell migration and peritoneal invasion, and it may be clinically useful as a prognostic tool and therapeutic target.
19915576 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19052657 Results show that CD38 and CD157 are expressed constitutively by corneal cells: CD38 appears as a 45-kDa monomer, while CD157 is a 42- to 45-kDa doublet.
18211745 The results confirm that CD157 physically interacts with CD11b/CD18 complex in human neutrophils
15328157 Deficient in paroxysmal nocturnal hemoglobinemia; crucial to regulation of innate immunity during inflammation.
12415565 CD157 molecule displays two distinct domains in its extracellular component. The first is implicated in the enzymic activities of the molecule and the second features adhesion/signalling properties [review]
11866528 crystal structures of the extracellular region of human BST-1 at atomic resolution in the free form and in complexes with five substrate analogues: nicotinamide, NMN, ATPgammaS, ethenoNADP, and ethenoNAD

AA Sequence

MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAI      1 - 70
WEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADF     71 - 140
LSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYE    141 - 210
IPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDC    211 - 280
ALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL                                    281 - 318
//

Text Mined References (52)

PMID Year Title
25986899 2015 Association between bone marrow stromal cell antigen 1 gene polymorphisms and the susceptibility to Parkinson's disease: a meta-analysis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25250980 2014 A pre-steady state and steady state kinetic analysis of the N-ribosyl hydrolase activity of hCD157.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
24896331 2014 The ADP-ribosyl cyclases--the current evolutionary state of the ARCs.
24795584 2014 Anxiety- and depression-like behavior in mice lacking the CD157/BST1 gene, a risk factor for Parkinson's disease.
24753259 2014 Binding of CD157 protein to fibronectin regulates cell adhesion and spreading.
24634087 2014 A deletion involving CD38 and BST1 results in a fusion transcript in a patient with autism and asthma.
24413464 2014 Novel SCRG1/BST1 axis regulates self-renewal, migration, and osteogenic differentiation potential in mesenchymal stem cells.
24342025 2014 BST1 rs11724635 interacts with environmental factors to increase the risk of Parkinson's disease in a Taiwanese population.
23853107 2013 Analysis of genome-wide association study-linked loci in Parkinson's disease of Mainland China.
23827523 2013 Exonic sequencing revealed no causative mutation in the BST1 gene in patients with Parkinson's disease.
23820587 2013 Alzheimer's disease and Parkinson's disease genome-wide association study top hits and risk of Parkinson's disease in Korean population.
23576305 CD38 and CD157: a long journey from activation markers to multifunctional molecules.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23026536 2012 Lack of association between BST1 polymorphisms and sporadic Parkinson's disease in a Japanese population.
22916288 2012 Overexpression of CD157 contributes to epithelial ovarian cancer progression by promoting mesenchymal differentiation.
22490479 2012 Lack of association between three single nucleotide polymorphisms in the PARK9, PARK15, and BST1 genes and Parkinson's disease in the northern Han Chinese population.
22451204 2012 Meta-analysis of Parkinson's disease: identification of a novel locus, RIT2.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
21478153 2011 The CD157-integrin partnership controls transendothelial migration and adhesion of human monocytes.
21292315 2011 Imputation of sequence variants for identification of genetic risks for Parkinson's disease: a meta-analysis of genome-wide association studies.
21248740 2011 Genome-wide association study confirms extant PD risk loci among the Dutch.
21084426 2011 Genome-wide association study confirms BST1 and suggests a locus on 12q24 as the risk loci for Parkinson's disease in the European population.
21044948 2011 Dissection of the genetics of Parkinson's disease identifies an additional association 5' of SNCA and multiple associated haplotypes at 17q21.
20711177 2010 Common genetic variation in the HLA region is associated with late-onset sporadic Parkinson's disease.
20697102 2010 Analysis of GWAS-linked loci in Parkinson disease reaffirms PARK16 as a susceptibility locus.
20639476 2010 Functional role and prognostic significance of CD157 in ovarian carcinoma.
19915576 2009 Genome-wide association study identifies common variants at four loci as genetic risk factors for Parkinson's disease.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19052657 CD38 and CD157 ectoenzymes mark cell subsets in the human corneal limbus.
18211745 2007 CD157 is part of a supramolecular complex with CD11b/CD18 on the human neutrophil cell surface.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15328157 2004 CD157 is an important mediator of neutrophil adhesion and migration.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12415565 2002 CD157, the Janus of CD38 but with a unique personality.
11866528 2002 Crystallographic studies on human BST-1/CD157 with ADP-ribosyl cyclase and NAD glycohydrolase activities.
11602246 2001 Signalling of GPI-anchored CD157 via focal adhesion kinase in MCA102 fibroblasts.
11439087 2001 Site-directed removal of N-glycosylation sites in BST-1/CD157: effects on molecular and functional heterogeneity.
10599889 1999 Expression of homing receptors and related molecules on human mast cells and basophils: a comparative analysis using multi-color flow cytometry and toluidine blue/immunofluorescence staining techniques.
9030974 1996 Genomic structure of human BST-1.
8941363 1996 Human BST-1 expressed on myeloid cells functions as a receptor molecule.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8645283 1996 Pancreatic islet cells express BST-1, a CD38-like surface molecule having ADP-ribosyl cyclase activity.
8630113 1996 Elevated levels of the soluble form of bone marrow stromal cell antigen 1 in the sera of patients with severe rheumatoid arthritis.
8202488 1994 BST-1, a surface molecule of bone marrow stromal cell lines that facilitates pre-B-cell growth.
7805847 1994 ADP ribosyl cyclase activity of a novel bone marrow stromal cell surface molecule, BST-1.