Property Summary

NCBI Gene PubMed Count 29
PubMed Score 47.60
PubTator Score 35.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
BARTTER SYNDROME, TYPE 4A 3 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 2.7e-04
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 0.0 5.0
Disease Target Count Z-score Confidence
Bartter disease 13 6.924 3.5
Disease Target Count
Bartter disease type 4a 3

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.064 2.7e-04

Gene RIF (22)

AA Sequence

MADEKTFRIGFIVLGLFLLALGTFLMSHDRPQVYGTFYAMGSVMVIGGIIWSMCQCYPKITFVPADSDFQ      1 - 70
GILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPK     71 - 140
LGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSS    141 - 210
PNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEA    211 - 280
SDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG                                  281 - 320
//

Text Mined References (28)

PMID Year Title