Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 3.5e-08
osteosarcoma 7950 2.4e-04
medulloblastoma, large-cell 6241 1.6e-03
adult high grade glioma 3801 2.1e-03
Multiple myeloma 1332 2.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.100 2.1e-03
medulloblastoma, large-cell -1.300 1.6e-03
Multiple myeloma 1.008 2.6e-03
osteosarcoma -1.043 2.4e-04
ovarian cancer -1.600 3.5e-08

 Compartment GO Term (1)

AA Sequence

MAEGEDVGWWRSWLQQSYQAVKEKSSEALEFMKRDLTEFTQVVQHDTACTIAATASVVKEKLATEGSSGA      1 - 70
TEKMKKGLSDFLGVISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYCNEPDGPP     71 - 140
ELFDAWLSQFCLEEKKGEISELLVGSPSIRALYTKMVPAAVSHSEFWHRYFYKVHQLEQEQARRDALKQR    141 - 210
AEQSISEEPGWEEEEEELMGISPISPKEAKVPVAKISTFPEGEPGPQSPCEENLVTSVEPPAEVTPSESS    211 - 280
ESISLVTQIANPATAPEARVLPKDLSQKLLEASLEEQGLAVDVGETGPSPPIHSKPLTPAGHTGGPEPRP    281 - 350
PARVETLREEAPTDLRVFELNSDSGKSTPSNNGKKGSSTDISEDWEKDFDLDMTEEEVQMALSKVDASGE    351 - 420
LEDVEWEDWE                                                                421 - 430
//

Text Mined References (16)

PMID Year Title