Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P59051 A1L3W1 D3DSH8
Symbols C21orf87
BRWD1-IT2
NCRNA00257

 Compartment GO Term (0)

AA Sequence

MLGWIQPSRQPQLRAAPPTRTPSAKRCILCNFLPGCWLVGDVAGSRQPSAPQTLRQRQHTRPPPQERGSG      1 - 70
RRSPLREARRANPHFKSFPVLEARGLPCGARRTGPRRPVREMTLPSDPERATLPNPRLGAPAVPRRGPRS     71 - 140
HGGRR                                                                     141 - 145
//

Text Mined References (5)

PMID Year Title