Property Summary

NCBI Gene PubMed Count 26
PubMed Score 80.08
PubTator Score 61.12

Knowledge Summary

Patent (3,600)

Expression

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (12)

PMID Text
24047693 SAD-A and AMPK kinases are regulators of mTORC1 signaling in the pancreatic beta-cells.
23907667 BRSK2 interacted with VCP/p97 via three of the four functional domains of VCP/p97. Immunofluorescence demonstrated that BRSK2 and VCP/p97 were co-localized and also that knockdown of endogenous BRSK2 induced increased levels of CD3delta.
23029325 Anaphase-promoting complex/cyclosome-Cdh1, rather than Cdc20, promotes the degradation of BRSK2 in vivo.
22798068 a novel function of BRSK2 in the regulation of GSIS in beta-cells via a PCTAIRE1-dependent mechanism and suggest that BRSK2 is an attractive target for developing novel diabetic drugs.
22713462 these findings demonstrate ER stress may reduce BRSK2 protein and change BRSK2 subcellular localization, which in turn alleviate ER stress-induced apoptosis.
22609399 these findings provide a novel regulatory mechanism of BRSK2 through direct interaction with Jab1.
20646422 BRSK2 is up-regulated in pancreatic ductal adenocarcinoma.
18854318 STRADalpha.MO25alpha complexes containing LKB1 variants were equally effective at phosphorylating and activating AMPK, BRSK1, and BRSK2
18794342 level of SAD within neurons is modulated by TORC1
18339622 protein phosphatase 2C is a likely candidate for catalyzing the dephosphorylation and inactivation of BRSK1/2.
16870137 we identified cAMP-dependent protein kinase A (PKA) as another upstream kinase of BRSK2, which can phosphorylate BRSK2 at Thr260. Kinase activity of BRSK2 can be increased through phosphorylation by PKA.
16165222 BRSK2 may be an autoantigen involved in the pathogenesis of small-cell lung cancer-associated limbic encephalitis.

AA Sequence

MTSTGKDGGAQHAQYVGPYRLEKTLGKGQTGLVKLGVHCVTCQKVAIKIVNREKLSESVLMKVEREIAIL      1 - 70
KLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQIISALDFCHSHSICHR     71 - 140
DLKPENLLLDEKNNIRIADFGMASLQVGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALL    141 - 210
VGALPFDDDNLRQLLEKVKRGVFHMPHFIPPDCQSLLRGMIEVDAARRLTLEHIQKHIWYIGGKNEPEPE    211 - 280
QPIPRKVQIRSLPSLEDIDPDVLDSMHSLGCFRDRNKLLQDLLSEEENQEKMIYFLLLDRKERYPSQEDE    281 - 350
DLPPRNEIDPPRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPARRAIEMAQHGQRSRSISGASSGL    351 - 420
STSPLSSPRVTPHPSPRGSPLPTPKGTPVHTPKESPAGTPNPTPPSSPSVGGVPWRARLNSIKNSFLGSP    421 - 490
RFHRRKLQVPTPEEMSNLTPESSPELAKKSWFGNFISLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSL    491 - 560
SHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQ    561 - 630
AQLLSTHDPPAAQHLSDTTNCMEMMTGRLSKCGSPLSNFFDVIKQLFSDEKNGQAAQAPSTPAKRSAHGP    631 - 700
LGDSAAAGPGPGGDAEYPTGKDTAKMGPPTARREQP                                      701 - 736
//

Text Mined References (32)

PMID Year Title
24429156 2013 Genetic variants associated with idiopathic pulmonary fibrosis susceptibility and mortality: a genome-wide association study.
24047693 2013 SAD-A and AMPK kinases: the "yin and yang" regulators of mTORC1 signaling in pancreatic ? cells.
23907667 2013 BRSK2 is a valosin-containing protein (VCP)-interacting protein that affects VCP functioning in endoplasmic reticulum-associated degradation.
23029325 2012 APC/C(Cdh1) targets brain-specific kinase 2 (BRSK2) for degradation via the ubiquitin-proteasome pathway.
22798068 2012 Brain-selective kinase 2 (BRSK2) phosphorylation on PCTAIRE1 negatively regulates glucose-stimulated insulin secretion in pancreatic ?-cells.
22713462 2012 BRSK2 is regulated by ER stress in protein level and involved in ER stress-induced apoptosis.
22669945 2012 Synapses of amphids defective (SAD-A) kinase promotes glucose-stimulated insulin secretion through activation of p21-activated kinase (PAK1) in pancreatic ?-Cells.
22609399 2012 Jab1 interacts with brain-specific kinase 2 (BRSK2) and promotes its degradation in the ubiquitin-proteasome pathway.
21985311 2012 Phosphorylation of microtubule-associated protein tau by AMPK-related kinases.
20646422 2010 [Clinical implication of BRSK2 expression in pancreatic ductal adenocarcinoma].
20026642 2010 Persistence of the cell-cycle checkpoint kinase Wee1 in SadA- and SadB-deficient neurons disrupts neuronal polarity.
19958286 2010 Calmodulin-dependent protein kinase kinase-beta activates AMPK without forming a stable complex: synergistic effects of Ca2+ and AMP.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18854318 2009 C-terminal phosphorylation of LKB1 is not required for regulation of AMP-activated protein kinase, BRSK1, BRSK2, or cell cycle arrest.
18794342 2008 The Tsc1-Tsc2 complex influences neuronal polarity by modulating TORC1 activity and SAD levels.
18339622 2008 Investigating the regulation of brain-specific kinases 1 and 2 by phosphorylation.
16870137 2006 BRSK2 is activated by cyclic AMP-dependent protein kinase A through phosphorylation at Thr260.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16630837 2006 SAD: a presynaptic kinase associated with synaptic vesicles and the active zone cytomatrix that regulates neurotransmitter release.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16165222 2005 BR serine/threonine kinase 2: a new autoantigen in paraneoplastic limbic encephalitis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15150265 2004 Human SAD1 kinase is involved in UV-induced DNA damage checkpoint function.
14976552 2004 LKB1 is a master kinase that activates 13 kinases of the AMPK subfamily, including MARK/PAR-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11124703 2001 Characterization of 16 novel human genes showing high similarity to yeast sequences.
9929968 1999 Repeat-directed isolation of a novel gene preferentially expressed from the maternal allele in human placenta.
9852686 1998 A HhaI/BstUI polymorphism in a novel gene at human chromosome 11p15.5.