Property Summary

NCBI Gene PubMed Count 19
PubMed Score 161.15
PubTator Score 84.12

Knowledge Summary

Patent (14,212)

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 2.6e-09
medulloblastoma, large-cell 6234 7.4e-05
Disease Target Count Z-score Confidence
Obesity 616 4.011 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.400 7.4e-05
ovarian cancer -1.700 2.6e-09

Gene RIF (13)

PMID Text
26020940 mammalian homologue of CCHa2-R, Bombesin receptor subtype-3 (Brs3), is an orphan receptor that is expressed in the islet beta-cells
25241033 High BRS3 expression is associated with liver metastases of pancreas neuroendocrine tumors.
24326363 Data show that gastrin-releasing peptide receptor/bombesin receptor subtype-3 positive cells and protein expression in tumors decreased by treatment with RC-3095 or gemcitabine alone or greater in combination.
24220502 The role of the human BRS-3 receptor in glucose homeostasis.
23291341 BRS-3 plays an important role in glucose metabolism.
22127929 BRS-3 agonist-dependent signaling mediates CREB phosphorylation and transactivation through protein kinase (PK)A, (PK)C, and mitogen-activated protein/extracellular regulated kinase kinase (MEK)-1 pathways.
21878513 These results identify a potential role for BRS-3 in islet physiology, with agonism directly promoting glucose-stimulated insulin secretion
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17714959 The secretion of TGF-beta1 increased and the synthesis of PGE2 decreased from BRS-3-activated BEC, which were correlated with the proliferation and collagen synthesis of HLF.
17355223 Data suggest that activator protein 2alpha and peroxisome-proliferator-activated receptor alpha may be especially involved in the ozone-inducible up-regulation mechanism of bombesin receptor subtype 3 expression.
16979789 Study found that the BRS-3 agonist stimulated adhesion of NCI-N417 cells in laminin-coated culture wells suggesting that BRS-3 may be involved in invasion and metastasis of certain cancer cells
12102638 results indicate that the sequence variation in the E3 loop is responsible for the species difference between rat and human BRS-3, and multiple residues in the E3 loop are involved in interactions with the agonist dY-bombesin

AA Sequence

MAQRQPHSPNQTLISITNDTESSSSVVSNDNTNKGWSGDNSPGIEALCAIYITYAVIISVGILGNAILIK      1 - 70
VFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGCKVLSFIRLTSVGVSVFTLTI     71 - 140
LSADRYKAVVKPLERQPSNAILKTCVKAGCVWIVSMIFALPEAIFSNVYTFRDPNKNMTFESCTSYPVSK    141 - 210
KLLQEIHSLLCFLVFYIIPLSIISVYYSLIARTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALF    211 - 280
ALCWLPNHLLYLYHSFTSQTYVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKA    281 - 350
ERPEPPVADTSLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF                         351 - 399
//

Text Mined References (20)

PMID Year Title
26020940 2015 The Nutrient-Responsive Hormone CCHamide-2 Controls Growth by Regulating Insulin-like Peptides in the Brain of Drosophila melanogaster.
25241033 2014 Gene expression accurately distinguishes liver metastases of small bowel and pancreas neuroendocrine tumors.
24326363 2014 RC-3095, a gastrin-releasing peptide receptor antagonist, synergizes with gemcitabine to inhibit the growth of human pancreatic cancer CFPAC-1 in vitro and in vivo.
24220502 2014 Human BRS-3 receptor: functions/role in cell signaling pathways and glucose metabolism in obese or diabetic myocytes.
23291341 2013 Bombesin receptor subtype-3 (BRS-3), a novel candidate as therapeutic molecular target in obesity and diabetes.
22127929 2012 A selective human bombesin receptor subtype-3 peptide agonist mediates CREB phosphorylation and transactivation.
21878513 2011 Bombesin receptor subtype-3 (BRS-3) regulates glucose-stimulated insulin secretion in pancreatic islets across multiple species.
21857995 2011 Cloning of a novel protein interacting with BRS-3 and its effects in wound repair of bronchial epithelial cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17714959 2007 BRS-3 activation transforms the effect of human bronchial epithelial cells from PGE2 mediated inhibition to TGF-beta1 dependent promotion on proliferation and collagen synthesis of lung fibroblasts.
17355223 2007 PPARalpha and AP-2alpha regulate bombesin receptor subtype 3 expression in ozone-stressed bronchial epithelial cells.
16979789 2006 Activation of bombesin receptor subtype-3 stimulates adhesion of lung cancer cells.
15772651 2005 The DNA sequence of the human X chromosome.
12102638 2002 Molecular basis of the pharmacological difference between rat and human bombesin receptor subtype-3 (BRS-3).
9593699 1998 Ability of various bombesin receptor agonists and antagonists to alter intracellular signaling of the human orphan receptor BRS-3.
9367152 1997 Mice lacking bombesin receptor subtype-3 develop metabolic defects and obesity.
8822519 1996 Bombesin-like peptide receptors in human bronchial epithelial cells.
8383682 1993 BRS-3: a novel bombesin receptor subtype selectively expressed in testis and lung carcinoma cells.
8131855 1994 Organization and chromosomal localization of the gene for the human bombesin receptor subtype expressed in pregnant uterus.