Property Summary

NCBI Gene PubMed Count 14
PubMed Score 29.12
PubTator Score 17.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3163 6.9e-07
psoriasis 6685 8.2e-05
acute myeloid leukemia 785 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Adult medulloblastoma 2 4.185 2.1

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.400 6.9e-07
psoriasis 1.400 8.2e-05
acute myeloid leukemia 1.200 1.2e-02

Protein-protein Interaction (7)

Gene RIF (7)

PMID Text
25281266 critical insights into the molecular mechanism of ligand binding by the BRPF1 bromodomain
24333487 novel interactions of the BRPF1 bromodomain with multiple acetyllysine residues on the N-terminus of histones show that it preferentially selects for H2AK5ac, H4K12ac, and H3K14ac
24258712 MOZ-TIF2/BRPF1 complex upregulates HOX genes mediated by MOZ-dependent histone acetylation, leading to the development of leukemia.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20400950 Identified is the PWWP domain of bromo and plant homeodomain (PHD) finger-containing protein 1 (BRPF1) as a histone H3 (H3K36me3) binding module; determined is the structure of this domain in complex with an H3K36me3-derived peptide.
19913121 Observational study of gene-disease association. (HuGE Navigator)
18051367 HIV-1 Tat upregulates bromodomain and PHD finger-containing protein 1 (BRPF1) in HEK 293T cells

AA Sequence

MGVDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDNPPPPQQTPLRKHKKKGRQSRP      1 - 70
ANKQSPSPSEVSQSPGREVMSYAQAQRMVEVDLHGRVHRISIFDNLDVVSEDEEAPEEAPENGSNKENTE     71 - 140
TPAATPKSGKHKNKEKRKDSNHHHHHNVSASTTPKLPEVVYRELEQDTPDAPPRPTSYYRYIEKSAEELD    141 - 210
EEVEYDMDEEDYIWLDIMNERRKTEGVSPIPQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICN    211 - 280
DGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAH    281 - 350
VVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLY    351 - 420
MKMEPVRETGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEDEDEEEDEGKGWSSEKVKKAKAKS    421 - 490
RIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRL    491 - 560
QTHLQSQRNCDQVGRDSEDKNWALKEQLKSWQRLRHDLERARLLVELIRKREKLKRETIKVQQIAMEMQL    561 - 630
TPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLI    631 - 700
VSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGIDFETGMHIPHSLAGDEATHHTEDAAEEER    701 - 770
LVLLENQKHLPVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPS    771 - 840
SRGSLTPHPAACDKDGQTDSAAEESSSQETSKGLGPNMSSTPAHEVGRRTSVLFSKKNPKTAGPPKRPGR    841 - 910
PPKNRESQMTPSHGGSPVGPPQLPIMSSLRQRKRGRSPRPSSSSDSDSDKSTEDPPMDLPANGFSGGNQP    911 - 980
VKKSFLVYRNDCSLPRSSSDSESSSSSSSSAASDRTSTTPSKQGRGKPSFSRGTFPEDSSEDTSGTENEA    981 - 1050
YSVGTGRGVGHSMVRKSLGRGAGWLSEDEDSPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPI   1051 - 1120
PVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQI   1121 - 1190
AYHRALQHRSKVQGEQSSETSDSD                                                 1191 - 1214
//

Text Mined References (26)

PMID Year Title
25281266 2014 Structural insights into recognition of acetylated histone ligands by the BRPF1 bromodomain.
24333487 2014 Molecular insights into the recognition of N-terminal histone modifications by the BRPF1 bromodomain.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24258712 2014 Bromodomain-PHD finger protein 1 is critical for leukemogenesis associated with MOZ-TIF2 fusion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21720545 2011 Structural and histone binding ability characterizations of human PWWP domains.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20400950 2010 Molecular basis of histone H3K36me3 recognition by the PWWP domain of Brpf1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18794358 2008 Molecular architecture of quartet MOZ/MORF histone acetyltransferase complexes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16387653 2006 ING tumor suppressor proteins are critical regulators of chromatin acetylation required for genome expression and perpetuation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8946209 1996 Gene BR140, which is related to AF10 and AF17, maps to chromosome band 3p25.
7906940 1994 BR140, a novel zinc-finger protein with homology to the TAF250 subunit of TFIID.