Property Summary

NCBI Gene PubMed Count 5
PubMed Score 52.70
PubTator Score 1.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.181 3.4e-02
ependymoma -1.100 2.1e-07
atypical teratoid / rhabdoid tumor -1.400 1.7e-06
glioblastoma -1.500 2.7e-05
sonic hedgehog group medulloblastoma -1.300 2.0e-03
medulloblastoma, large-cell -1.900 3.1e-05
adult high grade glioma -1.300 7.5e-03
aldosterone-producing adenoma -1.032 2.9e-02
pituitary cancer 1.200 2.1e-07

 GO Function (1)

 GO Component (1)

AA Sequence

MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRMECLDEMSNLEK      1 - 70
QFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQ     71 - 140
ASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSELWNDELQSRKKRKDPFSPDKKKPVVVSGPY    141 - 210
IVYMLQDLDILEDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKD    211 - 280
ECPTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYSIKHS                               281 - 323
//

Text Mined References (11)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15451426 2004 Identification of a novel BRMS1-homologue protein p40 as a component of the mSin3A/p33(ING1b)/HDAC1 deacetylase complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.