Property Summary

NCBI Gene PubMed Count 18
PubMed Score 29.18
PubTator Score 15.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 3.7e-03
primary pancreatic ductal adenocarcinoma 1271 4.1e-03
Disease Target Count Z-score Confidence
Hemangioma 35 3.598 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.016 4.1e-03
ovarian cancer 1.100 3.7e-03

Synonym

Accession Q8WUW1 B2R5E2 Q9P082 BRK1
Symbols MDS027
hHBrk1
C3orf10
HSPC300

Gene

PDB

3P8C   4N78  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (7)

PMID Text
24680773 Sp1 transcriptionally regulates BRK1 expression in non-small cell lung cancer cells.
23939472 We verified that NRF-1 positively regulates FAM134C and ENOX1, and negatively regulates C3orf10 in human neuroblastoma IMR-32 cells and primary rat cortical neurons.
20861187 Data show that Brk1 downregulation results in defective directional migration and invasive growth in renal cell carcinoma cells as well as in other tumor cell types.
19764026 Growing body of evidence suggesting that patients with VHL syndrome caused by large VHL deletions that include C3orf10 may be designated as having a specific subtype (Type 1B) of the disorder.
19764026 Observational study of gene-disease association. (HuGE Navigator)
19576655 higher expression in primary lung tumours with lymph node metastases and also in tumours from patients with more advanced disease
17311301 Von Hippel-Lindau (VHL) locus deletion of the HSPC300 actin regulator gene greatly lowers risk of clear cell renal cell carcinoma development in Spanish VHL syndrome patients studied.

AA Sequence

MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK      1 - 70
GETLT                                                                      71 - 75
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24680773 2014 Sp1 transcriptionally regulates BRK1 expression in non-small cell lung cancer cells.
24439377 2014 Local F-actin network links synapse formation and axon branching.
23939472 2013 Novel genes FAM134C, C3orf10 and ENOX1 are regulated by NRF-1 and differentially regulate neurite outgrowth in neuroblastoma cells and hippocampal neurons.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
21107423 2010 Structure and control of the actin regulatory WAVE complex.
20861187 2010 Brick1 is an essential regulator of actin cytoskeleton required for embryonic development and cell transformation.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19764026 2009 Genotype-phenotype correlations in VHL exon deletions.
19576655 2009 Metastatic potential of lung squamous cell carcinoma associated with HSPC300 through its interaction with WAVE2.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18560548 2008 Free Brick1 is a trimeric precursor in the assembly of a functional wave complex.
17311301 2007 Loss of the actin regulator HSPC300 results in clear cell renal cell carcinoma protection in Von Hippel-Lindau patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15070726 2004 Purification and architecture of the ubiquitous Wave complex.
15048733 2004 CYFIP2 is highly abundant in CD4+ cells from multiple sclerosis patients and is involved in T cell adhesion.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14695531 2004 Solid renal tumor severity in von Hippel Lindau disease is related to germline deletion length and location.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12181570 2002 Mechanism of regulation of WAVE1-induced actin nucleation by Rac1 and Nck.
9463375 1998 In mouse brain profilin I and profilin II associate with regulators of the endocytic pathway and actin assembly.
8605018 1996 Molecular cloning of p125Nap1, a protein that associates with an SH3 domain of Nck.