Property Summary

NCBI Gene PubMed Count 110
PubMed Score 73.28
PubTator Score 111.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Breast cancer 3098 0.0 5.0
Disease Target Count Z-score Confidence
Fanconi's anemia 50 0.0 4.0

Expression

Gene RIF (101)

PMID Text
26709662 BRIP1 might be the gene involved in the onset of breast cancer in families that do not show BRACA1/2 mutations (Review)
26637282 Fancj helicase-deficient mice, while phenotypically resembling Fanconi anemia (FA), are also hypersensitive to replication inhibitors and predisposed to lymphoma
26336824 FANCJ protein is important for the stability of FANCD2/FANCI proteins and protects them from proteasome and caspase-3 dependent degradation.
26315354 Deleterious germline mutations in BRIP1 are associated with a moderate increase in the risk of EOC Epithelial Ovarian Cancer).
26055704 our data point to the existence of a functional interplay between hMSH5 and FANCJ in double-strand break repair induced by replication stress.
25659033 FANCJ and BRCA2 share FANCD2's role in replication fork restart.
25483079 In coordination with BRCA1, FancJ promotes DNA damage-induced centrosome amplification in DNA damaged cells.
25070891 Our results suggest not only that FANCD2 regulates FANCJ chromatin localization but also that FANCJ is necessary for efficient loading of FANCD2 onto chromatin following DNA damage caused by mitomycin C treatment.
25045080 Genetic variants in BRIP1 (BACH1) contribute to risk of nonsyndromic cleft lip with or without cleft palate.
24966277 FANCJ-MLH1 interaction is important for DNA damage responses.
24895130 Fanconi anemia group J (FANCJ) helicase partners with the single-stranded DNA-binding protein replication protein A (RPA) to displace BamHI-E111A bound to duplex DNA in a specific manner.
24708616 The assessment of FANCD2, RAD51, BRCA1 and BRIP1 nuclear proteins could provide important information about the patients at risk for treatment failure.
24573678 analysis of two Fanconi anemia patient mutations, R251C and Q255H, that are localized in helicase motif Ia of FANCJ
24351291 FANCJ localization by mismatch repair is vital to maintain genomic integrity after UV irradiation.
24301948 SNPs in BRIP1 are significantly associated with breast cancer.
24040146 Loss of BRIP1 thus disrupts normal mammary morphogenesis and causes neoplastic-like changes, possibly via dysregulating multiple cellular signaling pathways functioning in the normal development of mammary glands.
23644138 BRIP1 gene polymorphisms play a role in cervical cancer in Chinese Han population.
23530059 FANCJ helicase and MRE11 nuclease interact to facilitate the DNA damage response.
23473757 SNPs in the BRIP1 gene may influence cervical cancer susceptibility in a Chinese Han population.
23225146 variant alleles in two (Pro919Ser and G64A) of the three BRIP1 polymorphisms elicited no associations with breast cancer risk
23157317 FANCJ phosphorylation is strongly induced by DNA-damaging agents.
23108394 BRIP1 is a direct transcription target of FOXM1. Depletion of FOXM1 downregulates BRIP1 expression at the protein & mRNA levels. FOXM1 regulates BRIP1 expression to modulate epirubicin-induced DNA damage repair and drug resistance.
22968820 The results strongly suggest that the decrease in FANCJ caused by 5-fluorouracil leads to an increase in sensitivity to oxaliplatin, indicating that the FANCJ protein plays an important role in the synergism of the combination of 5FU and oxaliplatin
22792074 We show that acetylation at lysine 1249 is a critical regulator of FANCJ function during cellular DNA repair.
22692731 germline mutations in BRIP1 and PALB2 contribute marginally to breast cancer susceptibility in ethnically diverse, Jewish high risk families
22582397 the Q motif is essential for FANCJ enzymatic activity in vitro and DNA repair function in vivo
22526901 FANCJ expression may be a useful biomarker to predict sensitivity to 5-fluorouracil and prognosis in colorectal cancer.
22137763 Downregulation of BRIP1, a physiological partner of BRCA1 in the DNA repair pathway, triggers BRCA1 chromatin dissociation.
21409391 six missense variants predicted to be causative were detected, one in BRIP1 and five in PALB2
21356067 The BRIP1 gene was screened for mutations in well-characterized, Finnish, high-risk hereditary breast and/or ovarian cancer individuals.
21240188 FANCJ catalytic activity and its effect on BLM protein stability contribute to preservation of genomic stability and a normal response to replication stress.
21165771 BRIP1 gene variants may not play a relevant role in Male Breast Cancer predisposition
21127055 Molecular basis of BACH1/FANCJ recognition by TopBP1 in DNA replication checkpoint control.
20978114 we uncover an MLH1 clinical mutation with a leucine (L)-to-histidine (H) amino acid change at position 607 in hereditary nonpolyposis colon cancer that ablates MLH1 binding to FANCJ
20676667 FANCJ is recruited in response to replication stress and serves to link FANCD2 to BRCA1.
20639400 recombinant FANCJ-A349P protein had reduced iron and was defective in coupling ATP hydrolysis and translocase activity to unwinding forked duplex or G-quadruplex DNA substrates or disrupting protein-DNA complexes
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
20567916 Genomic rearrangements of the BRIP1 gene is associated with breast cancer.
20567916 Observational study of gene-disease association. (HuGE Navigator)
20332657 FancB (FAAP95, FA core complex)showed differences in methylation in HNSCC.
20173781 in human cells BRCA1 binding to FANCJ is critical to regulate DNA repair choice and promote genomic stability.
20159562 The interaction between TopBP1 and BACH1 is required for the extension of single-stranded DNA regions and RPA loading following replication stress, which is a prerequisite for the subsequent activation of replication checkpoint.
20150366 Observational study of gene-disease association. (HuGE Navigator)
19935797 Epac inhibits migration and proliferation of human prostate carcinoma cells.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19763819 CHEK2_1100delC and BRIP1 mutations incidence in Ireland is similar to that found in other unselected breast cancer cohorts from northern European countries.
19763819 Observational study of gene-disease association. (HuGE Navigator)
19748364 Recruitment of fanconi anemia and breast cancer proteins to DNA damage sites is differentially governed by replication.
19714462 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19690177 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19584272 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19536649 Observational study of gene-disease association. (HuGE Navigator)
19504183 Our results suggest that large genomic deletions in BRIP1/FANCJ, PALB2/FANCN, and FANCD2 do not contribute significantly to the familial breast cancer risk in the Dutch population
19484476 Observational study of gene-disease association. (HuGE Navigator)
19419957 specific functional interaction between RPA and FANCJ on the thymine glycol substrates
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19150983 FANCJ can inhibit RAD51 strand exchange, an activity that is likely to be important for its role in controlling DNA repair through homologous recombination.
19127258 recurrent truncating germline mutation in the BRIP1 gene is associated with prostate cancer.
19127258 Observational study of gene-disease association. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
19116388 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19064565 The rare allele of BRIP1 rs2191249 shows evidence of association with a poorer prognosis in breast neoplasms.
19064565 Observational study of gene-disease association. (HuGE Navigator)
19012493 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19011769 no defect in FANCD2 ubiquitination, BRCA2 and FANCJ expression; absence of FANCN protein in three cell lines: HT, Sudhl4 and JEKO-1.
18978354 FANCJ (BACH1) has a role in the maintenance of potentially unstable genomic G/C tracts during replication
18950845 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18628483 evidence of a breast cancer-related role for BRIP1.
18557994 analysis of how the breast cancer genes ATM, BRIP1, PALB2 and CHEK2 affect risk for women with strong family histories [review]
18483852 germline mutations in BRIP1/BACH are extremely rare in BRCA1/BRCA2 negative Chinese women with early onset breast cancer or affected relatives
18483852 Observational study of gene-disease association. (HuGE Navigator)
18426915 a FANCJ helicase mutant unwinds G-quadruplex DNA to defend genomic stability
18414782 Unlikely to be a high-risk predisposition gene in non-BRCA1/2 high-risk families but may be associated with other cancers.
18414782 Observational study of gene-disease association. (HuGE Navigator)
18345034 Brip1 is a genuine target gene for the E2F/Rb pathway; elevated expression levels of Brip1 are detected in primary invasive breast carcinomas with unfavorable characteristics.
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17664283 Results point to a critical role for BACH1 helicase activity not only in the timely progression through the S phase by association with BRCA1/BRCA2, but also in maintaining genomic stability.
17596542 FANCJ-replication protein A interaction is likely to be important for the role of the helicase to more efficiently unwind DNA repair intermediates to maintain genomic stability
17581638 predicts a broader role for FANCJ in DNA damage signaling independent of BRCA1
17557904 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17504528 Observational study of gene-disease association. (HuGE Navigator)
17342202 Possible association of this protein with ovarian cancer risks warrants confirmation in independent case-control studies.
17342202 Observational study of gene-disease association. (HuGE Navigator)
17033622 Observational study of gene-disease association. (HuGE Navigator)
17033622 Mutations in the Fanconi anemia J gene BRIP1 are low-penetrance breast cancer susceptibility alleles.
16485136 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16430786 Observational study of gene-disease association. (HuGE Navigator)
16153896 BACH1 is FANCJ in a Fanconi anemia patient.
16116424 Single Nucleotide Polymorphism in BRIP1 is associated with Fanconi anemia
15878853 BACH1 requires nucleic acid continuity in the 5 ' ssDNA tail of the forked duplex substrate within six nucleotides of the ssDNA-dsDNA junction to initiate efficiently DNA unwinding
15133502 the X-ray crystal structure at a resolution of 1.85 A of the BRCA1 tandem BRCT domains in complex with a phosphorylated peptide representing the minimal interacting region of the DEAH-box helicase BACH1.
15125843 The phosphorylated serine 990 and phenylalanine 993 of BACH1 anchor the binding to BRCA1 through specific interactions with a surface cleft at the junction of the two BRCT repeats
15113441 Observational study of gene-disease association. (HuGE Navigator)
14576433 findings show that the BRCA1 BRCT domain directly interacts with phosphorylated BACH1; interaction is cell cycle regulated and required for DNA damage-induced checkpoint control during the transition from G2 to M phase of the cell cycle
12872252 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12872252 BRIP1 missense mutation found in a BRCA1/2-negative proband with breast cancer.

AA Sequence

MSSMWSEYTIGGVKIYFPYKAYPSQLAMMNSILRGLNSKQHCLLESPTGSGKSLALLCSALAWQQSLSGK      1 - 70
PADEGVSEKAEVQLSCCCACHSKDFTNNDMNQGTSRHFNYPSTPPSERNGTSSTCQDSPEKTTLAAKLSA     71 - 140
KKQASIYRDENDDFQVEKKRIRPLETTQQIRKRHCFGTEVHNLDAKVDSGKTVKLNSPLEKINSFSPQKP    141 - 210
PGHCSRCCCSTKQGNSQESSNTIKKDHTGKSKIPKIYFGTRTHKQIAQITRELRRTAYSGVPMTILSSRD    211 - 280
HTCVHPEVVGNFNRNEKCMELLDGKNGKSCYFYHGVHKISDQHTLQTFQGMCKAWDIEELVSLGKKLKAC    281 - 350
PYYTARELIQDADIIFCPYNYLLDAQIRESMDLNLKEQVVILDEAHNIEDCARESASYSVTEVQLRFARD    351 - 420
ELDSMVNNNIRKKDHEPLRAVCCSLINWLEANAEYLVERDYESACKIWSGNEMLLTLHKMGITTATFPIL    421 - 490
QGHFSAVLQKEEKISPIYGKEEAREVPVISASTQIMLKGLFMVLDYLFRQNSRFADDYKIAIQQTYSWTN    491 - 560
QIDISDKNGLLVLPKNKKRSRQKTAVHVLNFWCLNPAVAFSDINGKVQTIVLTSGTLSPMKSFSSELGVT    561 - 630
FTIQLEANHIIKNSQVWVGTIGSGPKGRNLCATFQNTETFEFQDEVGALLLSVCQTVSQGILCFLPSYKL    631 - 700
LEKLKERWLSTGLWHNLELVKTVIVEPQGGEKTNFDELLQVYYDAIKYKGEKDGALLVAVCRGKVSEGLD    701 - 770
FSDDNARAVITIGIPFPNVKDLQVELKRQYNDHHSKLRGLLPGRQWYEIQAYRALNQALGRCIRHRNDWG    771 - 840
ALILVDDRFRNNPSRYISGLSKWVRQQIQHHSTFESALESLAEFSKKHQKVLNVSIKDRTNIQDNESTLE    841 - 910
VTSLKYSTPPYLLEAASHLSPENFVEDEAKICVQELQCPKIITKNSPLPSSIISRKEKNDPVFLEEAGKA    911 - 980
EKIVISRSTSPTFNKQTKRVSWSSFNSLGQYFTGKIPKATPELGSSENSASSPPRFKTEKMESKTVLPFT    981 - 1050
DKCESSNLTVNTSFGSCPQSETIISSLKIDATLTRKNHSEHPLCSEEALDPDIELSLVSEEDKQSTSNRD   1051 - 1120
FETEAEDESIYFTPELYDPEDTDEEKNDLAETDRGNRLANNSDCILAKDLFEIRTIKEVDSAREVKAEDC   1121 - 1190
IDTKLNGILHIEESKIDDIDGNVKTTWINELELGKTHEIEIKNFKPSPSKNKGMFPGFK              1191 - 1249
//

Text Mined References (114)

PMID Year Title
26709662 2016 BRIP1, a potential candidate gene in development of non-BRCA1/2 breast cancer.
26637282 2015 FANCJ suppresses microsatellite instability and lymphomagenesis independent of the Fanconi anemia pathway.
26336824 2015 FANCJ protein is important for the stability of FANCD2/FANCI proteins and protects them from proteasome and caspase-3 dependent degradation.
26315354 2015 Germline Mutations in the BRIP1, BARD1, PALB2, and NBN Genes in Women With Ovarian Cancer.
26055704 2015 hMSH5 Facilitates the Repair of Camptothecin-induced Double-strand Breaks through an Interaction with FANCJ.
25659033 2015 FANCD2, FANCJ and BRCA2 cooperate to promote replication fork recovery independently of the Fanconi Anemia core complex.
25483079 2014 BRCA1 and FancJ cooperatively promote interstrand crosslinker induced centrosome amplification through the activation of polo-like kinase 1.
25070891 2014 The Fanconi anemia proteins FANCD2 and FANCJ interact and regulate each other's chromatin localization.
25045080 2014 Genetic variants in BRIP1 (BACH1) contribute to risk of nonsyndromic cleft lip with or without cleft palate.
24966277 2014 Crosstalk between BRCA-Fanconi anemia and mismatch repair pathways prevents MSH2-dependent aberrant DNA damage responses.
24895130 2014 Novel function of the Fanconi anemia group J or RECQ1 helicase to disrupt protein-DNA complexes in a replication protein A-stimulated manner.
24708616 2014 Gene expression profiling reveals activation of the FA/BRCA pathway in advanced squamous cervical cancer with intrinsic resistance and therapy failure.
24573678 2014 Insight into the roles of helicase motif Ia by characterizing Fanconi anemia group J protein (FANCJ) patient mutations.
24351291 2014 FANCJ localization by mismatch repair is vital to maintain genomic integrity after UV irradiation.
24301948 2013 Further evidence for the contribution of the BRCA1-interacting protein-terminal helicase 1 (BRIP1) gene in breast cancer susceptibility.
24040146 2013 Loss of the BRCA1-interacting helicase BRIP1 results in abnormal mammary acinar morphogenesis.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
23644138 2013 First evidence for the contribution of the genetic variations of BRCA1-interacting protein 1 (BRIP1) to the genetic susceptibility of cervical cancer.
23530059 2013 Fanconi anemia group J helicase and MRE11 nuclease interact to facilitate the DNA damage response.
23473757 2013 BRIP1 variations analysis reveals their relative importance as genetic susceptibility factor for cervical cancer.
23225146 2013 Association between BRIP1 (BACH1) polymorphisms and breast cancer risk: a meta-analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23157317 2012 CtIP- and ATR-dependent FANCJ phosphorylation in response to DNA strand breaks mediated by DNA replication.
23108394 2013 The Forkhead Box M1 protein regulates BRIP1 expression and DNA damage repair in epirubicin treatment.
22968820 2013 Decreased FANCJ caused by 5FU contributes to the increased sensitivity to oxaliplatin in gastric cancer cells.
22792074 2012 FANCJ/BACH1 acetylation at lysine 1249 regulates the DNA damage response.
22692731 2012 Germline mutations in BRIP1 and PALB2 in Jewish high cancer risk families.
22582397 2012 The Q motif of Fanconi anemia group J protein (FANCJ) DNA helicase regulates its dimerization, DNA binding, and DNA repair function.
22526901 2012 FANCJ expression predicts the response to 5-fluorouracil-based chemotherapy in MLH1-proficient colorectal cancer.
22137763 2011 Oncogenic RAS regulates BRIP1 expression to induce dissociation of BRCA1 from chromatin, inhibit DNA repair, and promote senescence.
21964575 2011 Mutations in BRIP1 confer high risk of ovarian cancer.
21409391 2011 BRIP1, PALB2, and RAD51C mutation analysis reveals their relative importance as genetic susceptibility factors for breast cancer.
21356067 2011 Screening for BRCA1, BRCA2, CHEK2, PALB2, BRIP1, RAD50, and CDH1 mutations in high-risk Finnish BRCA1/2-founder mutation-negative breast and/or ovarian cancer individuals.
21240188 2011 Interaction between the helicases genetically linked to Fanconi anemia group J and Bloom's syndrome.
21165771 2011 Mutation analysis of BRIP1 in male breast cancer cases: a population-based study in Central Italy.
21127055 2011 Molecular basis of BACH1/FANCJ recognition by TopBP1 in DNA replication checkpoint control.
20978114 2010 An MLH1 mutation links BACH1/FANCJ to colon cancer, signaling, and insight toward directed therapy.
20676667 2010 FANCJ/BRIP1 recruitment and regulation of FANCD2 in DNA damage responses.
20639400 2010 Fanconi anemia group J mutation abolishes its DNA repair function by uncoupling DNA translocation from helicase activity or disruption of protein-DNA complexes.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20567916 2010 Screening for large genomic rearrangements of the BRIP1 and CHK1 genes in Finnish breast cancer families.
20332657 2010 Inactivation of the tumor suppressor genes causing the hereditary syndromes predisposing to head and neck cancer via promoter hypermethylation in sporadic head and neck cancers.
20173781 2010 Targeting the FANCJ-BRCA1 interaction promotes a switch from recombination to poleta-dependent bypass.
20159562 2010 BACH1/FANCJ acts with TopBP1 and participates early in DNA replication checkpoint control.
20150366 2010 DNA repair gene polymorphisms and risk of adult meningioma, glioma, and acoustic neuroma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19935797 2009 Absence of truncating BRIP1 mutations in chromosome 17q-linked hereditary prostate cancer families.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19763819 2010 Evaluation of variants in the CHEK2, BRIP1 and PALB2 genes in an Irish breast cancer cohort.
19748364 2009 Recruitment of fanconi anemia and breast cancer proteins to DNA damage sites is differentially governed by replication.
19714462 2010 Genetic variation in genes interacting with BRCA1/2 and risk of breast cancer in the Cypriot population.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19690177 2009 Polymorphic variants in hereditary pancreatic cancer genes are not associated with pancreatic cancer risk.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19584272 2009 Modification of ovarian cancer risk by BRCA1/2-interacting genes in a multicenter cohort of BRCA1/2 mutation carriers.
19536649 2009 The Fanconi anemia family of genes and its correlation with breast cancer susceptibility and breast cancer features.
19504183 2009 Lack of large genomic deletions in BRIP1, PALB2, and FANCD2 genes in BRCA1/2 negative familial breast cancer.
19484476 2009 Polymorphisms in BRCA1, BRCA1-interacting genes and susceptibility of breast cancer in Chinese women.
19419957 2009 FANCJ helicase uniquely senses oxidative base damage in either strand of duplex DNA and is stimulated by replication protein A to unwind the damaged DNA substrate in a strand-specific manner.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19150983 2009 FANCJ uses its motor ATPase to destabilize protein-DNA complexes, unwind triplexes, and inhibit RAD51 strand exchange.
19127258 2009 A recurrent truncating germline mutation in the BRIP1/FANCJ gene and susceptibility to prostate cancer.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19116388 2009 A field synopsis on low-penetrance variants in DNA repair genes and cancer susceptibility.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19064565 2008 Common single-nucleotide polymorphisms in DNA double-strand break repair genes and breast cancer risk.
19012493 2009 Common variants in immune and DNA repair genes and risk for human papillomavirus persistence and progression to cervical cancer.
19011769 2008 Defects of FA/BRCA pathway in lymphoma cell lines.
18987736 2008 DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.
18978354 2008 FANCJ is a structure-specific DNA helicase associated with the maintenance of genomic G/C tracts.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18628483 2008 A novel breast cancer-associated BRIP1 (FANCJ/BACH1) germ-line mutation impairs protein stability and function.
18557994 2008 Are the so-called low penetrance breast cancer genes, ATM, BRIP1, PALB2 and CHEK2, high risk for women with strong family histories?
18483852 2009 Mutation analysis of BRIP1/BACH1 in BRCA1/BRCA2 negative Chinese women with early onset breast cancer or affected relatives.
18426915 2008 FANCJ helicase defective in Fanconia anemia and breast cancer unwinds G-quadruplex DNA to defend genomic stability.
18414782 2008 Mutational analysis of the breast cancer susceptibility gene BRIP1 /BACH1/FANCJ in high-risk non-BRCA1/BRCA2 breast cancer families.
18345034 2008 Expression of the BRCA1-interacting protein Brip1/BACH1/FANCJ is driven by E2F and correlates with human breast cancer malignancy.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17664283 2007 Activation of BRCA1/BRCA2-associated helicase BACH1 is required for timely progression through S phase.
17596542 2007 FANCJ (BACH1) helicase forms DNA damage inducible foci with replication protein A and interacts physically and functionally with the single-stranded DNA-binding protein.
17581638 2007 The FANCJ/MutLalpha interaction is required for correction of the cross-link response in FA-J cells.
17557904 2007 Evaluation of genetic variation in the double-strand break repair pathway and bladder cancer risk.
17525340 2007 Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response.
17504528 2007 BRIP1 (BACH1) variants and familial breast cancer risk: a case-control study.
17342202 2007 Tagging single nucleotide polymorphisms in the BRIP1 gene and susceptibility to breast and ovarian cancer.
17033622 2006 Truncating mutations in the Fanconi anemia J gene BRIP1 are low-penetrance breast cancer susceptibility alleles.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16485136 2006 Polymorphisms in DNA double-strand break repair genes and risk of breast cancer: two population-based studies in USA and Poland, and meta-analyses.
16430786 2006 BACH1 Ser919Pro variant and breast cancer risk.
16153896 2005 BACH1 is critical for homologous recombination and appears to be the Fanconi anemia gene product FANCJ.
16116424 2005 The BRCA1-interacting helicase BRIP1 is deficient in Fanconi anemia.
16116423 2005 The DNA helicase BRIP1 is defective in Fanconi anemia complementation group J.
16116421 2005 The BRIP1 helicase functions independently of BRCA1 in the Fanconi anemia pathway for DNA crosslink repair.
15878853 2005 Analysis of the DNA substrate specificity of the human BACH1 helicase associated with breast cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15133502 2004 Structure and mechanism of BRCA1 BRCT domain recognition of phosphorylated BACH1 with implications for cancer.
15125843 2004 Structure of the BRCT repeats of BRCA1 bound to a BACH1 phosphopeptide: implications for signaling.
15113441 2004 Kin-cohort estimates for familial breast cancer risk in relation to variants in DNA base excision repair, BRCA1 interacting and growth factor genes.
14983014 2004 The BRCA1-associated protein BACH1 is a DNA helicase targeted by clinically relevant inactivating mutations.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14576433 2003 The BRCT domain is a phospho-protein binding domain.
14576432 2003 BRCT repeats as phosphopeptide-binding modules involved in protein targeting.
12872252 2003 Mutational analysis of the BRCA1-interacting genes ZNF350/ZBRK1 and BRIP1/BACH1 among BRCA1 and BRCA2-negative probands from breast-ovarian cancer families and among early-onset breast cancer cases and reference individuals.
12565990 2003 No evidence of involvement of germline BACH1 mutations in Finnish breast and ovarian cancer families.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11920628 2002 No mutations in the BACH1 gene in BRCA1 and BRCA2 negative breast-cancer families linked to 17q22.
11595410 2001 SUVi and BACH1: a new subfamily of mammalian helicases?
11301010 2001 BACH1, a novel helicase-like protein, interacts directly with BRCA1 and contributes to its DNA repair function.