Property Summary

NCBI Gene PubMed Count 17
PubMed Score 11.33
PubTator Score 13.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -4.400 1.1e-09
posterior fossa group B ependymoma -3.000 1.1e-07
medulloblastoma -3.200 5.1e-05
glioblastoma -1.900 4.6e-02
medulloblastoma, large-cell -4.000 1.9e-05
primitive neuroectodermal tumor -2.200 3.4e-02
colon cancer -3.100 4.1e-08
active Crohn's disease -2.031 3.2e-02
pilocytic astrocytoma 1.600 5.8e-03
subependymal giant cell astrocytoma -1.393 4.4e-02
ductal carcinoma in situ 3.000 4.0e-02
ulcerative colitis -1.800 2.0e-06
pituitary cancer 4.800 1.6e-05

Gene RIF (14)

PMID Text
25887438 study provides evidence that the BRINP3 polymorphic variant rs1342913 and low level of BRINP3 expression are associated with peri-implantitis, independently from the presence of chronic periodontitis.
25251368 Data show that family with sequence similarity 5 member C protein FAM5C-positive endothelium expressed intercellular adhesion molecule-1 (ICAM-1) or vascular cell adhesion molecule-1 (VCAM-1).
25171508 Under expression of BRINP3 is associated with the pathogenesis of ulcerative colitis.
22377736 Hypermethylated FAM5C and MYLK in serum are strongly associated with the development of gastric cancer and can be used as potential biomarkers for diagnosis and pre-warning.
22355820 expression does not contribute to chronic periodontitis
22013132 findings suggest a protective effect of T allele in women with a history of myocardial infarction (MI;) genotype of FAM5C rs10920501 explained about 7percent of variability of age of onset of coronary heart disease in women who have had an MI; FAM5C remains a gene of interest in a complex disease process
20383335 FAM5C mRNA expression was significantly higher in aggressive periodontitis diseased versus healthy sites, and was found to be correlated to the IL-1beta, IL-17A, IL-4 and RANKL mRNA levels.
20383335 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19787213 Loss of FAM5C is associated with tongue squamous cell carcinoma.
18430236 These data implicate FAM5C alleles in the risk of myocardial infarction and suggest further functional studies of FAM5C are required to identify the gene's contribution to atherosclerosis
18430236 Observational study of gene-disease association. (HuGE Navigator)
17903301 Genome-wide association study of gene-disease association. (HuGE Navigator)
17138656 BRINP3 is a mitochondrially localized protein that is selectively up-regulated in human gonadotropinomas; its actions to increase proliferation, migration, and invasion suggest it may play an important role in pituitary tumorigenesis

AA Sequence

MIWRSRAGAELFSLMALWEWIALSLHCWVLAVAAVSDQHATSPFDWLLSDKGPFHRSQEYTDFVDRSRQG      1 - 70
FSTRYKIYREFGRWKVNNLAVERRNFLGSPLPLAPEFFRNIRLLGRRPTLQQITENLIKKYGTHFLLSAT     71 - 140
LGGEESLTIFVDKRKLSKRAEGSDSTTNSSSVTLETLHQLAASYFIDRDSTLRRLHHIQIASTAIKVTET    141 - 210
RTGPLGCSNYDNLDSVSSVLVQSPENKIQLQGLQVLLPDYLQERFVQAALSYIACNSEGEFICKENDCWC    211 - 280
HCGPKFPECNCPSMDIQAMEENLLRITETWKAYNSDFEESDEFKLFMKRLPMNYFLNTSTIMHLWTMDSN    281 - 350
FQRRYEQLENSMKQLFLKAQKIVHKLFSLSKRCHKQPLISLPRQRTSTYWLTRIQSFLYCNENGLLGSFS    351 - 420
EETHSCTCPNDQVVCTAFLPCTVGDASACLTCAPDNRTRCGTCNTGYMLSQGLCKPEVAESTDHYIGFET    421 - 490
DLQDLEMKYLLQKTDRRIEVHAIFISNDMRLNSWFDPSWRKRMLLTLKSNKYKSSLVHMILGLSLQICLT    491 - 560
KNSTLEPVLAVYVNPFGGSHSESWFMPVNENSFPDWERTKLDLPLQCYNWTLTLGNKWKTFFETVHIYLR    561 - 630
SRIKSNGPNGNESIYYEPLEFIDPSRNLGYMKINNIQVFGYSMHFDPEAIRDLILQLDYPYTQGSQDSAL    631 - 700
LQLLEIRDRVNKLSPPGQRRLDLFSCLLRHRLKLSTSEVVRIQSALQAFNAKLPNTMDYDTTKLCS        701 - 766
//

Text Mined References (19)

PMID Year Title
25887438 2015 Different contribution of BRINP3 gene in chronic periodontitis and peri-implantitis: a cross-sectional study.
25251368 2014 Family with sequence similarity 5, member C (FAM5C) increases leukocyte adhesion molecules in vascular endothelial cells: implication in vascular inflammation.
25171508 2014 Mucosal transcriptomics implicates under expression of BRINP3 in the pathogenesis of ulcerative colitis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22377736 2012 Hypermethylated FAM5C and MYLK in serum as diagnosis and pre-warning markers for gastric cancer.
22355820 2012 A preliminary study on the FAM5C expression in generalized chronic periodontitis.
22013132 2013 The relationships between FAM5C SNP (rs10920501) variability and metabolic syndrome and inflammation in women with coronary heart disease.
20383335 2010 FAM5C contributes to aggressive periodontitis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19787213 2009 Expression of the FAM5C in tongue squamous cell carcinoma.
18430236 2008 Genetic and functional association of FAM5C with myocardial infarction.
17903301 2007 Genome-wide association of echocardiographic dimensions, brachial artery endothelial function and treadmill exercise responses in the Framingham Heart Study.
17138656 2007 Bone morphogenetic protein and retinoic acid-inducible neural specific protein-3 is expressed in gonadotrope cell pituitary adenomas and induces proliferation, migration, and invasion.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16018821 2005 Id4 and FABP7 are preferentially expressed in cells with astrocytic features in oligodendrogliomas and oligoastrocytomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15193423 2004 Identification and characterization of novel developmentally regulated neural-specific proteins, BRINP family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.