Property Summary

NCBI Gene PubMed Count 6
PubMed Score 5.24
PubTator Score 12.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Gene RIF (2)

PMID Text
17765869 Taken together, BRI3BP, widely expressed in animal cell types, seems to possess a pro-apoptotic property and can potentiate drug-induced apoptosis.
11860200 highly expressed in brain, kidney, and liver; mapped to human chromosome 12q24.2-qter

AA Sequence

MGARASGGPLARAGLLLLLLLLLLLGLLAPGAQGARGRGGAEKNSYRRTVNTFSQSVSSLFGEDNVRAAQ      1 - 70
KFLARLTERFVLGVDMFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVVLLAYWFLS     71 - 140
LTLGFTFSVLHVVFGRFFWIVRVVLFSMSCVYILHKYEGEPENAVLPLCFVVAVYFMTGPMGFYWRSSPS    141 - 210
GPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK                                 211 - 251
//

Text Mined References (9)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17943721 2008 HCCRBP-1 directly interacting with HCCR-1 induces tumorigenesis through P53 stabilization.
17765869 2007 Augmentation of drug-induced cell death by ER protein BRI3BP.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11860200 2001 Cloning, tissue expression pattern, and chromosome location of a novel human gene BRI3BP.