Property Summary

NCBI Gene PubMed Count 19
PubMed Score 3.14
PubTator Score 20.57

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (7)

Gene RIF (8)

PMID Text
26638071 Study solved crystal structures of a human Brf2-TATA-binding complex bound to natural promoters, obtaining a detailed view of the molecular interactions occurring at Brf2-dependent Pol III promoters and highlighting the general structural and functional conservation of human Pol II and Pol III pre-initiation complexes.
24978456 hnRNP F is a co-factor in a subset of tristetraprolin/BRF1/BRF2-mediated mRNA decay.
24738062 These results suggested that BRF2 overexpression in tumor tissues is significantly associated with the poor prognosis of NSCLC patients through promoting epithelial-mesenchymal transition (EMT) program.
24523874 BRF2 may have a role in poor prognosis and anti-angiogenic therapy for early-stage non-small cell lung cancer
23550276 High expression of BRF2 is closely associated with tumor progression, angiogenesis, and poor survival in esophageal squamous cell cancer.
20668658 BRF2 can serve as a marker for lung squamous cell carcinoma and may provide a novel target for therapy.
18700021 deregulation of Brf1 and Brf2 expression could be a key mechanism responsible for the observed deregulation of RNA pol III transcription in cancer cells
16227591 C-terminal domain of Brf2 is required for efficient association of the protein with U6 promoter-bound TBP and SNAP(c), a type 3 promoter-specific transcription factor, and for efficient recruitment of Bdp1

AA Sequence

MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQVSRSQQ      1 - 70
RGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRAARLQKKEVLVGCCVLITCRQHNWPLTMGAICT     71 - 140
LLYADLDVFSSTYMQIVKLLGLDVPSLCLAELVKTYCSSFKLFQASPSVPAKYVEDKEKMLSRTMQLVEL    141 - 210
ANETWLVTGRHPLPVITAATFLAWQSLQPADRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQL    211 - 280
AWLRVLRLDKRSVVKHIGDLLQHRQSLVRSAFRDGTAEVETREKEPPGWGQGQGEGEVGNNSLGLPQGKR    281 - 350
PASPALLLPPCMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQAATSVPNPP     351 - 419
//

Text Mined References (28)

PMID Year Title
26638071 2015 Redox Signaling by the RNA Polymerase III TFIIB-Related Factor Brf2.
24978456 2014 hnRNP F complexes with tristetraprolin and stimulates ARE-mRNA decay.
24738062 2014 TFIIB-related factor 2 is associated with poor prognosis of nonsmall cell lung cancer patients through promoting tumor epithelial-mesenchymal transition.
24523874 2014 TFIIB-related factor 2 over expression is a prognosis marker for early-stage non-small cell lung cancer correlated with tumor angiogenesis.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23550276 2013 Overexpression of TFIIB-related factor 2 is significantly correlated with tumor angiogenesis and poor survival in patients with esophageal squamous cell cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20668658 2010 Integrative genomic analyses identify BRF2 as a novel lineage-specific oncogene in lung squamous cell carcinoma.
18700021 2008 Differential expression of the TFIIIB subunits Brf1 and Brf2 in cancer cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17624304 2007 The green tea component EGCG inhibits RNA polymerase III transcription.
17505538 2007 Human Maf1 negatively regulates RNA polymerase III transcription via the TFIIB family members Brf1 and Brf2.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16769183 2006 A role for Yin Yang-1 (YY1) in the assembly of snRNA transcription complexes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16227591 2005 Structure-function analysis of the human TFIIB-related factor II protein reveals an essential role for the C-terminal domain in RNA polymerase III transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14527415 2003 A minimal RNA polymerase III transcription system from human cells reveals positive and negative regulatory roles for CK2.
12621023 2003 The small nuclear RNA-activating protein 190 Myb DNA binding domain stimulates TATA box-binding protein-TATA box recognition.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12391172 2002 Redundant cooperative interactions for assembly of a human U6 transcription initiation complex.
12016223 2002 Assembly of human small nuclear RNA gene-specific transcription factor IIIB complex de novo on and off promoter.
11564744 2001 BRFU, a TFIIB-like factor, is directly recruited to the TATA-box of polymerase III small nuclear RNA gene promoters through its interaction with TATA-binding protein.
11483580 2001 Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs.
11121026 2000 A stable complex of a novel transcription factor IIB- related factor, human TFIIIB50, and associated proteins mediate selective transcription by RNA polymerase III of genes with upstream promoter elements.
11040218 2000 Different human TFIIIB activities direct RNA polymerase III transcription from TATA-containing and TATA-less promoters.
10330166 1999 RNA polymerase III transcription factor IIIB is a target for repression by pocket proteins p107 and p130.