Property Summary

NCBI Gene PubMed Count 33
PubMed Score 158.83
PubTator Score 54.82

Knowledge Summary

Patent

No data available

Expression

Gene RIF (17)

PMID Text
25561519 BRF1 mutations that reduce protein activity cause neurodevelopmental anomalies, suggesting that BRF1-mediated Pol III transcription is required for normal cerebellar and cognitive development.
24978456 hnRNP F is a co-factor in a subset of tristetraprolin/BRF1/BRF2-mediated mRNA decay.
21832157 these observations are in favor of a cell- and context-dependent regulation of Tis11b by hypoxia, which then contributes to modulation of angiogenesis.
21106530 Alcohol induces RNA polymerase III-dependent transcription through c-Jun by co-regulating TATA-binding protein (TBP) and Brf1 expression.
21044367 Observational study of gene-disease association. (HuGE Navigator)
20154270 results identify a human Pol III isoform and isoform-specific functions in the regulation of cell growth and transformation
18700021 deregulation of Brf1 and Brf2 expression could be a key mechanism responsible for the observed deregulation of RNA pol III transcription in cancer cells
18326031 MK2-mediated inhibition of BRF1 requires phosphorylation at S54, S92, and S203.
17968325 Brf1 gene was identified in the genome-wide loss-of-function genetic screen as putative tumor suppressor located at 14q32.33.
17877750 the hypo-phosphorylated Rb appeared to be largely sequestered into a complex with Brf1, which resulted in the blockage of Rb function to repress E2F1 transactivation
17499043 Maf1 occupancy of Pol III genes is inversely correlated with that of the initiation factor TFIIIB (subunit Brf1) and Pol III.
17369404 depletion of endogenous TTP and BRF-1 proteins, or overexpression of dominant-negative mutant TTP proteins, impairs the localization of reporter AU-rich element mRNAs
16982688 These results suggest a direct role of an RNA polymerase III transcription factor in the targeting process.
15538381 Data report that protein kinase B (PKB/Akt) stabilizes ARE transcripts by phosphorylating butyrate response factor (BRF1) at serine 92.
12198173 BRF1 accelerated mRNA decay and antagonized the stabilizing effect of PI3-kinase, while mutation of the zinc fingers abolished both function and ARE-binding activity. This approach identifies BRF1 as an essential regulator of ARE-dependent mRNA decay.
12016223 human small nuclear RNA gene-specific transcription factor IIIB complex de novo on and off promoter
11997511 CK2 forms a stable complex with TFIIIB and activates RNA polymerase III transcription in human cells.

AA Sequence

MTGRVCRGCGGTDIELDAARGDAVCTACGSVLEDNIIVSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLG      1 - 70
GGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYLVC     71 - 140
RTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRL    141 - 210
LQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTIDEF    211 - 280
MKIDLEEECDPPSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAKDG    281 - 350
STEDTASSLCGEEDTEDEELEAAASHLNKDLYRELLGGAPGSSEAAGSPEWGGRPPALGSLLDPLPTAAS    351 - 420
LGISDSIRECISSQSSDPKDASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAEYLREQREKEA    421 - 490
RIAKEKELGIYKEHKPKKSCKRREPIQASTAREAIEKMLEQKKISSKINYSVLRGLSSAGGGSPHREDAQ    491 - 560
PEHSASARKLSRRRTPASRSGADPVTSVGKRLRPLVSTQPAKKVATGEALLPSSPTLGAEPARPQAVLVE    561 - 630
SGPVSYHADEEADEEEPDEEDGEPCVSALQMMGSNDYGCDGDEDDGY                           631 - 677
//

Text Mined References (40)

PMID Year Title
25561519 2015 BRF1 mutations alter RNA polymerase III-dependent transcription and cause neurodevelopmental anomalies.
24978456 2014 hnRNP F complexes with tristetraprolin and stimulates ARE-mRNA decay.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21832157 2011 A novel function of Tis11b/BRF1 as a regulator of Dll4 mRNA 3'-end processing.
21106530 2011 Alcohol induces RNA polymerase III-dependent transcription through c-Jun by co-regulating TATA-binding protein (TBP) and Brf1 expression.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
20154270 2010 Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18700021 2008 Differential expression of the TFIIIB subunits Brf1 and Brf2 in cancer cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18326031 2008 The AU-rich element mRNA decay-promoting activity of BRF1 is regulated by mitogen-activated protein kinase-activated protein kinase 2.
17968325 2008 Cellular senescence bypass screen identifies new putative tumor suppressor genes.
17877750 2008 Vaccinia virus-mediated cell cycle alteration involves inactivation of tumour suppressors associated with Brf1 and TBP.
17499043 2007 Mammalian Maf1 is a negative regulator of transcription by all three nuclear RNA polymerases.
17369404 2007 TTP and BRF proteins nucleate processing body formation to silence mRNAs with AU-rich elements.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16982688 2006 Role of RNA polymerase III transcription factors in the selection of integration sites by the dictyostelium non-long terminal repeat retrotransposon TRE5-A.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15538381 2004 The ARE-dependent mRNA-destabilizing activity of BRF1 is regulated by protein kinase B.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14592981 2003 TFIIIB is phosphorylated, disrupted and selectively released from tRNA promoters during mitosis in vivo.
12711686 2003 Assembly and isolation of intermediate steps of transcription complexes formed on the human 5S rRNA gene.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12198173 2002 Functional cloning of BRF1, a regulator of ARE-dependent mRNA turnover.
12066800 2002 A universal nomenclature for subunits of the RNA polymerase III transcription initiation factor TFIIIB.
11997511 2002 CK2 forms a stable complex with TFIIIB and activates RNA polymerase III transcription in human cells.
10921893 2000 Alternatively spliced hBRF variants function at different RNA polymerase III promoters.
10523658 1999 The TFIIIC90 subunit of TFIIIC interacts with multiple components of the RNA polymerase III machinery and contains a histone-specific acetyltransferase activity.
10373544 1999 Cloning and characterization of two evolutionarily conserved subunits (TFIIIC102 and TFIIIC63) of human TFIIIC and their involvement in functional interactions with TFIIIB and RNA polymerase III.
10330166 1999 RNA polymerase III transcription factor IIIB is a target for repression by pocket proteins p107 and p130.
9171375 1997 Three human RNA polymerase III-specific subunits form a subcomplex with a selective function in specific transcription initiation.
9169441 1997 RNA polymerase III transcription repressed by Rb through its interactions with TFIIIB and TFIIIC2.
8943363 1996 p53 inhibits RNA polymerase III-directed transcription in a promoter-dependent manner.
8943358 1996 RNA polymerase III transcription from the human U6 and adenovirus type 2 VAI promoters has different requirements for human BRF, a subunit of human TFIIIB.
7624363 1995 Structure and function of a human transcription factor TFIIIB subunit that is evolutionarily conserved and contains both TFIIB- and high-mobility-group protein 2-related domains.