Property Summary

NCBI Gene PubMed Count 36
PubMed Score 185.00
PubTator Score 54.82

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (20)

AA Sequence

MTGRVCRGCGGTDIELDAARGDAVCTACGSVLEDNIIVSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLG      1 - 70
GGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYLVC     71 - 140
RTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRL    141 - 210
LQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTIDEF    211 - 280
MKIDLEEECDPPSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAKDG    281 - 350
STEDTASSLCGEEDTEDEELEAAASHLNKDLYRELLGGAPGSSEAAGSPEWGGRPPALGSLLDPLPTAAS    351 - 420
LGISDSIRECISSQSSDPKDASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAEYLREQREKEA    421 - 490
RIAKEKELGIYKEHKPKKSCKRREPIQASTAREAIEKMLEQKKISSKINYSVLRGLSSAGGGSPHREDAQ    491 - 560
PEHSASARKLSRRRTPASRSGADPVTSVGKRLRPLVSTQPAKKVATGEALLPSSPTLGAEPARPQAVLVE    561 - 630
SGPVSYHADEEADEEEPDEEDGEPCVSALQMMGSNDYGCDGDEDDGY                           631 - 677
//

Text Mined References (43)

PMID Year Title