Property Summary

NCBI Gene PubMed Count 35
PubMed Score 70.17
PubTator Score 23.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 1963 3.6e-09
adrenocortical carcinoma 1385 8.5e-07
osteosarcoma 7766 4.4e-04
ovarian cancer 8297 8.3e-04
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma -1.642 8.5e-07
osteosarcoma -1.057 4.4e-04
ovarian cancer 1.200 8.3e-04
tuberculosis 1.700 3.6e-09

Gene RIF (12)

AA Sequence

MSPEVALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHIPYAGETLKWD      1 - 70
IIFNAQYPELPPDFIFGEDAEFLPDPSALQNLASWNPSNPECLLLVVKELVQQYHQFQCSRLRESSRLMF     71 - 140
EYQTLLEEPQYGENMEIYAGKKNNWTGEFSARFLLKLPVDFSNIPTYLLKDVNEDPGEDVALLSVSFEDT    141 - 210
EATQVYPKLYLSPRIEHALGGSSALHIPAFPGGGCLIDYVPQVCHLLTNKVQYVIQGYHKRREYIAAFLS    211 - 280
HFGTGVVEYDAEGFTKLTLLLMWKDFCFLVHIDLPLFFPRDQPTLTFQSVYHFTNSGQLYSQAQKNYPYS    281 - 350
PRWDGNEMAKRAKAYFKTFVPQFQEAAFANGKL                                         351 - 383
//

Text Mined References (44)

PMID Year Title