Property Summary

Ligand Count 13
NCBI Gene PubMed Count 45
PubMed Score 52.52
PubTator Score 39.96

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.500 2.8e-03
medulloblastoma, large-cell 1.400 1.0e-03
osteosarcoma -3.390 3.5e-12
primitive neuroectodermal tumor 1.100 1.4e-02
tuberculosis and treatment for 6 months 1.400 1.6e-03

Protein-protein Interaction (1)

Gene RIF (33)

AA Sequence

MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKDRKRKKRKKGE      1 - 70
KQIPGEEKGRKRRRVKEDKKKRDRDRVENEAEKDLQCHAPVRLDLPPEKPLTSSLAKQEEVEQTPLQEAL     71 - 140
NQLMRQLQRKDPSAFFSFPVTDFIAPGYSMIIKHPMDFSTMKEKIKNNDYQSIEELKDNFKLMCTNAMIY    141 - 210
NKPETIYYKAAKKLLHSGMKILSQERIQSLKQSIDFMADLQKTRKQKDGTDTSQSGEDGGCWQREREDSG    211 - 280
DAEAHAFKSPSKENKKKDKDMLEDKFKSNNLEREQEQLDRIVKESGGKLTRRLVNSQCEFERRKPDGTTT    281 - 350
LGLLHPVDPIVGEPGYCPVRLGMTTGRLQSGVNTLQGFKEDKRNKVTPVLYLNYGPYSSYAPHYDSTFAN    351 - 420
ISKDDSDLIYSTYGEDSDLPSDFSIHEFLATCQDYPYVMADSLLDVLTKGGHSRTLQEMEMSLPEDEGHT    421 - 490
RTLDTAKEMEITEVEPPGRLDSSTQDRLIALKAVTNFGVPVEVFDSEEAEIFQKKLDETTRLLRELQEAQ    491 - 560
NERLSTRPPPNMICLLGPSYREMHLAEQVTNNLKELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVD    561 - 630
LTEDTEEPKKTDVAECGPGGS                                                     631 - 651
//

Text Mined References (55)

PMID Year Title