Property Summary

NCBI Gene PubMed Count 42
PubMed Score 49.80
PubTator Score 39.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -3.390 3.5e-12
group 3 medulloblastoma 1.500 2.8e-03
medulloblastoma, large-cell 1.400 1.0e-03
primitive neuroectodermal tumor 1.100 1.4e-02
tuberculosis and treatment for 6 months 1.400 1.6e-03

Gene RIF (30)

PMID Text
27010857 the expression of miR-141 in BRD7-overexpressing NPC cells could partially reverse the tumor suppressive effect of BRD7 on cell proliferation and tumor growth in vitro and in vivo.
26620707 Propose that the balance between BRD7 function and Ras/Raf/MEK/ERK activity is important for determining the outcomes of HCV infection and HCC development.
26407966 constructed a regulating network of BRD7 downstream genes, and this network suggests multiple feedback regulations of the pathways. Furthermore, we validated BIRC2, BIRC3, TXN2, and NOTCH1 genes as direct, functional BRD7 targets
26149213 Data indicate that bromodomain-containing protein 7 (BRD7) was a direct target of microRNA-410 (miR-410).
26010572 Ectopic expression of BRD7 could significantly inhibit miR-300-promoted proliferation, invasion and epithelial-mesenchymal transition in osteosarcoma.
25743841 BRD7 promoter hypermethylation is an indicator of well differentiated oral squamous cell carcinomas.
24840027 lower BRD7 expression is an indicator for poor prognosis in patients with osteosarcoma.
24657164 BRD7-mediated translocation of a subfraction (but not all) of the p85 protein to the nucleus could enhance PI3K signaling.
24404152 Disturbing miR-182 and -381 inhibits BRD7 transcription and glioma growth by directly targeting LRRC4.
24198243 These results suggested that BRD7 acts as a tumor suppressor in epithelial ovarian cancers
23110154 Data show a substantial proportion of germ-line mutations in triple-negative breast cancer (TNBC), with a preponderance of BRCA1 mutations over mutations in BRCA2 or PALB2, but no evidence to implicate BRD7 mutations in the etiology of TNBC.
22864638 No evidence for breast cancer susceptibility is associated with variants of BRD7.
22015043 miR-200c inhibits the expression of BRD7. MiR-200c regulated the translocation of beta-catenin from the cytoplasm to the nucleus via inhibition of BRD7, resulting in increased expression of its transcriptional target genes, cyclinD1 and c-myc.
22008115 Data indicate that BRD7 may be related to the occurrence, development, and metastasis of lung cancers.
21873788 The region from aa219 to aa450 is primarily defined as an atypical nuclear export signal in BRD7.
20660729 as unique regulators of replicative senescence in human cells, both BRD7 and BAF180 regulate p53 transcriptional activity toward a subset of its target genes required for replicative and oncogenic stress senescence induction
20561408 All-trans retinoic acid enhances brd7 gene expression as HL-60 cells differentiate.
20228809 BRD7 suppresses tumorigenicity by serving as a p53 cofactor required for the efficient induction of p53-dependent oncogene-induced senescence.
19909775 TRIM24 regulates AR-mediated transcription in collaboration with TIP60 and BRD7.
19111069 c-Myc negatively regulates and Sp1 slightly positively regulate BRD7 promoter activity.
18809673 BRD7 is a novel PBAF-specific SWI/SNF subunit that is required for target gene activation and repression in embryonic stem cells
18778484 BRD7 promoter demethylation is a prerequisite for high level induction of BRD7 gene expression in human nasopharyngeal carcinoma cells
18772500 Observational study of gene-disease association. (HuGE Navigator)
16786191 The results showed that BRD7 could interact with BRD2 and the region from amino acid 430 to 798 of BRD2 was critical for the interaction of BRD2 with BRD7. BRD2 mainly localizes in nucleus and BRD2 has distinct roles in initiating apoptosis.
16475162 the nuclear localization of BRD7 is critical for the expression of cell cycle related molecules and cell biological function.
16265664 Taken together, the present work shed light on the fact that a novel bromodomain gene, BRD7, is of importance in transcriptional regulation and cellular events including cell cycle.
15137061 BRD7 inhibits G1-S progression by transcriptionally regulating some important molecules involved in ras/MEK/ERK and Rb/E2F pathways.
12918109 Expression levels of NAG-7, and BRD7 did not alter in gastric and colorectal cancers. NAG-7 and BRD7 genes may not play role in gastric and colorectal carcinogenesis.
12600283 BRD7 could up-regulate the expression levels of BRD2 and BRD3 genes in mRNA level to some extent.
12489984 Regulation of transcription by E1B-AP5 is mediated by complex formation with this protein.

AA Sequence

MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKDRKRKKRKKGE      1 - 70
KQIPGEEKGRKRRRVKEDKKKRDRDRVENEAEKDLQCHAPVRLDLPPEKPLTSSLAKQEEVEQTPLQEAL     71 - 140
NQLMRQLQRKDPSAFFSFPVTDFIAPGYSMIIKHPMDFSTMKEKIKNNDYQSIEELKDNFKLMCTNAMIY    141 - 210
NKPETIYYKAAKKLLHSGMKILSQERIQSLKQSIDFMADLQKTRKQKDGTDTSQSGEDGGCWQREREDSG    211 - 280
DAEAHAFKSPSKENKKKDKDMLEDKFKSNNLEREQEQLDRIVKESGGKLTRRLVNSQCEFERRKPDGTTT    281 - 350
LGLLHPVDPIVGEPGYCPVRLGMTTGRLQSGVNTLQGFKEDKRNKVTPVLYLNYGPYSSYAPHYDSTFAN    351 - 420
ISKDDSDLIYSTYGEDSDLPSDFSIHEFLATCQDYPYVMADSLLDVLTKGGHSRTLQEMEMSLPEDEGHT    421 - 490
RTLDTAKEMEITEVEPPGRLDSSTQDRLIALKAVTNFGVPVEVFDSEEAEIFQKKLDETTRLLRELQEAQ    491 - 560
NERLSTRPPPNMICLLGPSYREMHLAEQVTNNLKELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVD    561 - 630
LTEDTEEPKKTDVAECGPGGS                                                     631 - 651
//

Text Mined References (51)

PMID Year Title
27010857 2016 miR-141 is involved in BRD7-mediated cell proliferation and tumor formation through suppression of the PTEN/AKT pathway in nasopharyngeal carcinoma.
26620707 2016 Bromodomain containing protein represses the Ras/Raf/MEK/ERK pathway to attenuate human hepatoma cell proliferation during HCV infection.
26407966 2016 Integrating ChIP-sequencing and digital gene expression profiling to identify BRD7 downstream genes and construct their regulating network.
26149213 2015 MicroRNA-410 promotes cell proliferation by targeting BRD7 in non-small cell lung cancer.
26010572 2015 Up-Regulation of MiR-300 Promotes Proliferation and Invasion of Osteosarcoma by Targeting BRD7.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25743841 2015 BRD7 promoter hypermethylation as an indicator of well differentiated oral squamous cell carcinomas.
24840027 2014 Targeting the anaphase-promoting complex/cyclosome (APC/C)- bromodomain containing 7 (BRD7) pathway for human osteosarcoma.
24657164 2014 BRD7, a tumor suppressor, interacts with p85? and regulates PI3K activity.
24404152 2014 Disturbing miR-182 and -381 inhibits BRD7 transcription and glioma growth by directly targeting LRRC4.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24198243 2014 Tumor suppressive effects of bromodomain-containing protein 7 (BRD7) in epithelial ovarian carcinoma.
24124411 2013 Genome-wide association study of liver enzymes in korean children.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23110154 2012 Mutation analysis of BRCA1, BRCA2, PALB2 and BRD7 in a hospital-based series of German patients with triple-negative breast cancer.
22864638 2012 No evidence for breast cancer susceptibility associated with variants of BRD7, a component of p53 and BRCA1 pathways.
22015043 2012 The interactions between MicroRNA-200c and BRD7 in endometrial carcinoma.
22008115 2011 [Expression and clinical significance of bromodomain-containing protein 7 in non-small cell lung cancer].
21873788 2011 [Definition and function identification of nucleus export signal of BRD7].
21630459 2011 Proteomic characterization of the human sperm nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20660729 2010 Polybromo-associated BRG1-associated factor components BRD7 and BAF180 are critical regulators of p53 required for induction of replicative senescence.
20561408 2010 [The effect of ATRA-induced leukemic cell differentiation on Brd7 gene expression in leukemia cell lines].
20228809 2010 BRD7 is a candidate tumour suppressor gene required for p53 function.
20215511 2010 BRD7, a subunit of SWI/SNF complexes, binds directly to BRCA1 and regulates BRCA1-dependent transcription.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19909775 2009 TRIM24 mediates ligand-dependent activation of androgen receptor and is repressed by a bromodomain-containing protein, BRD7, in prostate cancer cells.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19111069 2008 Transcriptional regulation of BRD7 expression by Sp1 and c-Myc.
18809673 2008 BRD7, a novel PBAF-specific SWI/SNF subunit, is required for target gene activation and repression in embryonic stem cells.
18778484 2008 Promoter methylation inhibits BRD7 expression in human nasopharyngeal carcinoma cells.
18772500 2008 [Expression and SNP analysis of BRD7 gene in acute leukemia cells].
18329849 2008 Ceap/BLOS2 interacts with BRD7 and selectively inhibits its transcription-suppressing effect on cellular proliferation-associated genes.
17498659 2007 Solution structure of BRD7 bromodomain and its interaction with acetylated peptides from histone H3 and H4.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16792505 2006 Cloning and characterization of the BRD7 gene promoter.
16786191 2006 BRD2 is one of BRD7-interacting proteins and its over-expression could initiate apoptosis.
16475162 2006 Identification of nuclear localization signal that governs nuclear import of BRD7 and its essential roles in inhibiting cell cycle progression.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16265664 2006 The transcriptional regulation role of BRD7 by binding to acetylated histone through bromodomain.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15137061 2004 BRD7, a novel bromodomain gene, inhibits G1-S progression by transcriptionally regulating some important molecules involved in ras/MEK/ERK and Rb/E2F pathways.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12918109 2003 Expression of tumor related genes NGX6, NAG-7, BRD7 in gastric and colorectal cancer.
12766061 2003 Gene expression profile of the human trabecular meshwork: NEIBank sequence tag analysis.
12600283 2003 [Expression of BRD7-interacting proteins,BRD2 and BRD3, in nasopharyngeal carcinoma tissues].
12489984 2003 Regulation of transcription by the heterogeneous nuclear ribonucleoprotein E1B-AP5 is mediated by complex formation with the novel bromodomain-containing protein BRD7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11025449 2000 Molecular characterization of celtix-1, a bromodomain protein interacting with the transcription factor interferon regulatory factor 2.
10526152 1999 Identification and molecular characterization of BP75, a novel bromodomain-containing protein.